KEGG   Amycolicicoccus subflavus: AS9A_1854Help
Entry
AS9A_1854         CDS       T01514                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
asd  Amycolicicoccus subflavus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AS9A_1854
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AS9A_1854
Enzymes [BR:asd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     AS9A_1854
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1924849..1925799
Genome map
AA seq 316 aa AA seqDB search
MKHLLSVSDLTPDTALELLDEANRFEQALVGREVRKLPTLRGRTIMTVFYENSTRTRVSF
EVAGKWMSADVINVGISASSVSKGESLRDTAMTLHAAGADALVVRHPASGAPAQIANWTR
GPDGTGPAVINAGDGTHEHPTQALLDAYTLRQRLGEIAGRRIVIVGDVLHSRVARSNAQL
LAMLGAEVVLVAPPTLLPVGIDSWPVTVGHSLEAELPAADAVMMLRVQAERMNGSFFPSA
REYAISYGLNEKRMLMLPEHAVVLHPGPMVRGMEIGFSVADSPRSTVLQQVTNGVHIRMA
VLFRLLIGVDDAGEAV
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcacctcctgtcggtttccgatctcactccggacacggcgcttgagctcctagac
gaggcgaaccgtttcgaacaagcactggtcggccgcgaagtgcgcaaactccccacactg
cgcgggcgcacgatcatgacggtgttctacgagaattcgacccgcacacgcgtgtccttc
gaagtagcggggaagtggatgagcgccgacgtcatcaacgtcggcatcagcgcatcttcg
gtcagcaagggtgagtctcttcgcgacactgcgatgacgctgcacgcagcaggagcagat
gcgctggtagtgaggcatcccgcgtcgggcgcgccagcacagatcgcgaactggactcgc
ggcccggacgggactggccccgcagtgatcaacgcgggtgatggcacccatgagcatccg
acccaggcgctgctcgacgcgtacacgctccggcagcggctcggcgagatcgcgggccgt
cgcatcgtgatcgtgggcgacgtattgcacagcagggtcgcacgttccaacgcccagttg
ctcgcgatgctcggcgctgaggttgtgctcgttgcaccaccgacgttgctgccggtcggt
atcgactcgtggccggtgactgtcggacacagtctcgaggccgagctccccgcggccgat
gcagtgatgatgcttcgtgtgcaggccgagcgaatgaacggctcgttcttcccgtcagcg
cgggagtatgcaattagttatggcctcaatgaaaagcgaatgctgatgctccctgagcac
gcagtagtgctccacccaggtccgatggtacgaggaatggagatcggcttctcggttgcc
gactcaccccgttcgaccgtgctgcaacaggttaccaatggggtacacatccggatggca
gtgctattccgcctgctgataggcgtcgatgacgcaggggaggcagtgtga

DBGET integrated database retrieval system