KEGG   Amycolicicoccus subflavus: AS9A_1861Help
Entry
AS9A_1861         CDS       T01514                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
asd  Amycolicicoccus subflavus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AS9A_1861
Enzymes [BR:asd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     AS9A_1861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1933658..1934266
Genome map
AA seq 202 aa AA seqDB search
MNDSSGAAVSGTESAVQRRGRLVVLAGPSAVGKSTVVNRLREVVPDLWFSVSATTRDPRP
GEVSGRDYHFVSRAEFDRMIEAGELLEWADVHGGLQRSGTPKTPVAEALAAGKPVLLEVD
LAGARAVRERLAEATLVFLAPPSWQVLVDRLSGRGTEPPEVVARRLETARGELEAKHEFD
HVVVNDDVERAVEELVSLLVGA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgactcgtcaggcgcagccgtgtctggcaccgaatcggcagtacagcggaggggt
cggctggttgtgctagccggtccctccgctgtaggcaagtcgacagttgtgaaccgtctc
cgcgaggtggtgccagatctgtggttcagtgtgtcggcgacaacgcgagatccacgccct
ggcgaggtgtcaggcagggattatcactttgtgtcgcgcgctgagttcgatcggatgatc
gaagccggtgaacttcttgaatgggcggacgtgcacggaggcctccagcgttcagggacg
ccaaagacgccggtcgctgaggcactcgctgctggaaaacctgttctgctggaggtggat
ctcgcgggcgcgcgagcggtccgtgaacggctggccgaggcgaccctggtgttcctagcc
ccgccgagctggcaagttctggtggatcggctgtcgggcaggggaacggaaccgcccgag
gttgtcgcacgtcgtttagagacggcgcgcggggaactcgaagcgaaacatgagttcgat
catgtcgtcgtcaatgacgacgtggaacgtgcggtcgaggaattggtatccttgctcgtt
ggggcttga

DBGET integrated database retrieval system