KEGG   Hoyosella subflava: AS9A_1861Help
Entry
AS9A_1861         CDS       T01514                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
asd  Hoyosella subflava
Pathway
asd00230  Purine metabolism
asd01100  Metabolic pathways
Module
asd_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AS9A_1861
Enzymes [BR:asd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     AS9A_1861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 MMR_HSR1 RsgA_GTPase AAA_33 CPT AAA_29 AAA_22
Motif
Other DBs
NCBI-ProteinID: AEF40310
UniProt: F6EMF0
Position
1933658..1934266
Genome map
AA seq 202 aa AA seqDB search
MNDSSGAAVSGTESAVQRRGRLVVLAGPSAVGKSTVVNRLREVVPDLWFSVSATTRDPRP
GEVSGRDYHFVSRAEFDRMIEAGELLEWADVHGGLQRSGTPKTPVAEALAAGKPVLLEVD
LAGARAVRERLAEATLVFLAPPSWQVLVDRLSGRGTEPPEVVARRLETARGELEAKHEFD
HVVVNDDVERAVEELVSLLVGA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgactcgtcaggcgcagccgtgtctggcaccgaatcggcagtacagcggaggggt
cggctggttgtgctagccggtccctccgctgtaggcaagtcgacagttgtgaaccgtctc
cgcgaggtggtgccagatctgtggttcagtgtgtcggcgacaacgcgagatccacgccct
ggcgaggtgtcaggcagggattatcactttgtgtcgcgcgctgagttcgatcggatgatc
gaagccggtgaacttcttgaatgggcggacgtgcacggaggcctccagcgttcagggacg
ccaaagacgccggtcgctgaggcactcgctgctggaaaacctgttctgctggaggtggat
ctcgcgggcgcgcgagcggtccgtgaacggctggccgaggcgaccctggtgttcctagcc
ccgccgagctggcaagttctggtggatcggctgtcgggcaggggaacggaaccgcccgag
gttgtcgcacgtcgtttagagacggcgcgcggggaactcgaagcgaaacatgagttcgat
catgtcgtcgtcaatgacgacgtggaacgtgcggtcgaggaattggtatccttgctcgtt
ggggcttga

DBGET integrated database retrieval system