KEGG   Amycolicicoccus subflavus: AS9A_1890Help
Entry
AS9A_1890         CDS       T01514                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
asd  Amycolicicoccus subflavus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AS9A_1890 (tpiA)
   01230 Biosynthesis of amino acids
    AS9A_1890 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AS9A_1890 (tpiA)
   00051 Fructose and mannose metabolism
    AS9A_1890 (tpiA)
   00562 Inositol phosphate metabolism
    AS9A_1890 (tpiA)
Enzymes [BR:asd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AS9A_1890 (tpiA)
Exosome [BR:asd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AS9A_1890 (tpiA)
  Exosomal proteins of bladder cancer cells
   AS9A_1890 (tpiA)
  Exosomal proteins of melanoma cells
   AS9A_1890 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1959626..1960408
Genome map
AA seq 260 aa AA seqDB search
MPRKPLIAGNWKMNMNHLEAIALVQKIAFALPDKYYEKVDVVVVPPFTDLRSVQTLVEGD
KLKVAYGAQDVSVHESGAYTGEVSGPMLAKLGCKFVVVGHSERRIYHREDDELVSNKAKA
ALKHGLTPIICIGEGLDIREAGSHVEYNINQLRNSLAGLSQKELAKIVIAYEPVWAIGTG
KVASAADAQEVCSAIRSELSRIATPETAGTIRVLYGGSVSAKNVGSIVTESDVDGALVGG
ASLKADDFAQLCAIAAGGPF
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgtaagccgctcatcgcgggcaactggaagatgaacatgaatcatcttgaggcg
atcgcgctggtccagaagatcgccttcgcgctgcccgataagtactacgagaaggtggac
gtagtcgtcgtgccaccgttcaccgacctgcgcagcgttcagacgctggtcgaaggtgac
aagctgaaggtcgcctacggggcgcaagacgtcagtgttcacgaatcgggtgcctacacc
ggtgaggtgagcgggccgatgctggcgaaactcggctgcaaattcgtggtcgtgggccac
tcggagcgtcgcatttaccaccgtgaggacgatgaactcgtttcgaacaaggcaaaagcg
gcgctgaagcacgggctgaccccaatcatttgcatcggcgaggggctcgacatccgtgag
gctggctcgcatgttgaatacaacatcaaccagctgcgaaactcgctcgctgggttgtcg
cagaaagaactcgcgaagatcgtaatcgcctacgagcctgtgtgggcgataggaaccggc
aaggttgcgtccgcggctgacgcgcaagaggtgtgttccgcaatccgttcagagctgtcg
cgcatagcgacgcccgaaacggccggaaccatccgtgtgctgtacggaggttccgtcagc
gcgaaaaacgtcggttcgatcgtgacggaatctgatgtcgacggtgcccttgtaggtgga
gcctcactcaaggcggacgatttcgcgcagttgtgcgccatcgccgctggcggccccttc
tga

DBGET integrated database retrieval system