KEGG   Amycolicicoccus subflavus: AS9A_2153Help
Entry
AS9A_2153         CDS       T01514                                 

Definition
alcohol dehydrogenase
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
asd  Amycolicicoccus subflavus
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AS9A_2153
Enzymes [BR:asd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     AS9A_2153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2236015..2237040)
Genome map
AA seq 341 aa AA seqDB search
MKAVQVVGYHTKLQLNDIPVPKVESPFDVIVKIGGAGVCRTDLHILEGQWEEKTGVALPY
TIGHENAGWVHAIGSAVTNVSEGDKVILHPLITCGLCRACRFGDDVHCQNSSFPGIDTNG
GYAEYIRTTARSVVRIDDGLAPADVAALADAGLTAYHAIAKVARTTRPGDVCVVIGAGGL
GHIGIQVLKAISGATIVVLDRNPAAVDLALKIGADFGIVADGTQVEQVLELTRGHGAEAV
VDFVGEGGATREGVAMLRRAGNYFVVGYGENIDVPTIDIISTEINFIGNLVGSYNDLQEL
MVLAAQGKVTLHTTKYKLDEFQTALDDLDAGLVRGRAILVP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtacaagttgtgggttaccacacgaaactccagctcaacgacattcccgta
cccaaggtcgagagcccgttcgacgtaatcgtgaagatcggcggagcaggggtgtgccgg
acggatcttcacattcttgaaggccaatgggaagaaaaaaccggtgtcgcacttccctac
acgatcggtcatgagaatgcgggatgggtgcacgccatcggcagtgcagtcacgaatgtt
tccgagggtgacaaggtgatcctgcacccgttgatcacctgcgggctgtgccgcgcctgc
cgattcggcgacgacgtgcactgccagaacagcagttttcccggaatcgacacgaacggc
ggatacgcagaatacatccgaactactgcgcgcagcgtggtccggatcgatgacggactc
gcgcccgctgatgttgccgcgctcgcggatgcaggactgacggcctaccacgcgatcgcg
aaggttgcccggacaacccggcccggcgacgtgtgcgtcgtcatcggggctggaggtctc
ggccatatcgggatccaggtgctgaaggcgatttccggggcaacgatcgtcgttctcgac
cgcaaccccgcggccgtcgacctggctttgaagatcggcgcagacttcgggatcgtcgcc
gatggcacacaggtggagcaggtgctggaactgacgcgcggtcatggagctgaagccgtg
gtcgatttcgtcggcgagggcggtgccacccgcgagggcgtggcgatgctgcgtcgcgcc
ggaaactacttcgtcgtcggatacggcgagaacatcgacgtcccgacgatcgacatcatc
tccaccgaaatcaacttcatcggcaatctcgtgggttcttacaacgacctgcaagaactt
atggtgctcgcagcccaggggaaagtcaccttgcacaccacgaagtacaaactcgacgag
tttcagactgcgctagacgatctcgacgctggactagtccggggccgcgcgattctcgtt
ccataa

DBGET integrated database retrieval system