KEGG   Amycolicicoccus subflavus: AS9A_2338Help
Entry
AS9A_2338         CDS       T01514                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
asd  Amycolicicoccus subflavus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AS9A_2338
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    AS9A_2338
Enzymes [BR:asd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AS9A_2338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2401555..2402577
Genome map
AA seq 340 aa AA seqDB search
MDRRAFLRVAAVSGAIGALSAGGAIAPASPLGSIGAPLAGARRVIYSYPGATPPPELFDR
IRRGIGGVIFFGENITSGGQIADVVRQLTLTALGSGYVLRLFVDQEGGMVKRLPGGPAMS
AKQVGAQPDPGAAGGTQGTEAAMALLAAGMNANLAPVMGVYRSEGDFLDQYERSFGMNKE
TVAQAGSAFIRATQSMGVSACAKHFPGLGAASADENTDLGPVTIDLPEHVLSDIDEFPFR
AAVEAGVQMVMPSWAVYPSLDPARPSGMSSEILRGRLRGRLGFRGLIVTDAVEAGALAQY
GSTGNRAVTAVDAGVDLLCCSARDVAQGDEAAQALVMAGK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggatcgacgggcattcctcagagtagcggcggtctcgggcgcgatcggtgcgctctcg
gcaggcggggcgatcgccccagcctctcccctcggttcgatcggagcgccgctggccggc
gcgcgacgggtcatctattcgtaccctggtgctactcccccgccggaattgttcgaccgg
atccggcgcggcatcgggggcgtcatcttcttcggtgaaaacatcacgtcaggcgggcag
atcgctgacgtggtgcggcagttgacgctcactgcgctcggctccgggtatgtgttgcgg
cttttcgtcgaccaggaaggcggcatggtcaagcgcctaccgggcgggcccgcgatgtca
gctaaacaggttggcgcccagccagatccgggcgctgcaggaggaacgcaaggcacggag
gcagccatggcgctccttgcggcgggaatgaacgccaacctcgccccggtgatgggcgtc
taccgttccgagggagactttctcgaccaatacgagcgcagcttcggcatgaacaaggaa
acggtcgctcaggcgggttcggctttcattcgagcgacacaatcgatgggtgtcagtgcg
tgcgcaaagcatttcccgggcctgggcgcagcctccgccgatgagaacacggatttgggg
ccagtcactattgatctgccggagcacgtcctcagcgatattgacgagttcccgttcaga
gcggcggtagaggcgggggttcagatggtgatgccctcgtgggcggtgtacccctcactc
gaccctgcgcgcccgtcggggatgtcttctgaaatccttcgcgggcggttacgcggacga
cttgggttccggggcctgatcgtgaccgatgcggtagaggcaggggcgctggcgcagtac
ggaagcaccggcaatcgtgcggtcaccgccgtggacgccggggtcgatctgttgtgctgc
tcagcccgcgatgtcgcgcaaggtgacgaggcggcgcaagcgctggtgatggccggcaaa
taa

DBGET integrated database retrieval system