KEGG   Hoyosella subflava: AS9A_2383Help
Entry
AS9A_2383         CDS       T01514                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
asd  Hoyosella subflava
Pathway
asd00984  Steroid degradation
asd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    AS9A_2383
Enzymes [BR:asd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     AS9A_2383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C GMC_oxred_N DAO FAD_binding_2 Pyr_redox_2 NAD_binding_8 FAD_binding_3 Fer4_9 GIDA Fer4_10 Fer4_8 Fer4_21 Fer4 Fer4_6 HI0933_like Pyr_redox Fer4_7 FAD_oxidored Fer4_4
Motif
Other DBs
NCBI-ProteinID: AEF40830
UniProt: F6ES15
Position
complement(2445037..2446797)
Genome map
AA seq 586 aa AA seqDB search
MTFDYDVLVIGSGFGGSVAALRLTEKGYRVGVLEAGRRFDRDTLPKTSWDLRNFLWAPKL
RCFGMQRIHMVKDAVILAASGVGGGSLVYANTLYEPLDPFFRDKQWSHITDWRSELSPYY
RQAKSMLGVQTNPDVTAADEVMKQVAEEMGVGDTYHSTPVGVCFGGPATRPGESVGDPYF
GGAGPERHACIRCGECMTGCKYNAKNTLDKNYLHLAERNGAEVRPLTTVTAVRPLSEGGY
AVDTVRTGRSTHRRKNLATFTAEQVIFAAGTYNTQKLLHRLRDEGALPEVSPRLGELTRT
NSESILGAKSRSATNDYTRGVAITSSFHPDEHTHIEPVRYGKGSNAMGLLQTALTDGGEK
IPRWLTWVLTMILSPRNLTWFSVRRWSEKTIILLVMQTLDNSINIRGKKGLFGTYRLTSS
QGHGAPNPTWIPKGNETARRVSKKIGGVPGGTIGEIANIPMTAHFIGGCPIGDSRDTGVI
DPWHRIYGHPGLHVTDGSAITANLGVNPSLTITAQAERALAFWPNKGQADSRPPVGSGYT
RLPAVAPQHPAVPEHAPAALHLPIADVTHGRALTATPGPNAEKELS
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgacctttgactatgacgttctcgtgatcggctctggattcggcggctcggtcgccgcg
ttacggctcaccgagaaaggctaccgagttggtgtgctcgaggccggacgccgattcgac
cgtgacactctccctaaaacctcatgggatctgcggaacttcctgtgggcccccaagctg
cggtgcttcggtatgcagcgcatccacatggtgaaggacgcggtaatcctcgctgcttcc
ggtgtcggcggcgggtcgctggtgtacgccaacacgttgtatgaaccactcgatcccttt
ttccgggacaagcagtggtcccatatcactgactggcgctcggaactcagtccgtactac
cggcaggccaagtccatgctcggcgtgcagaccaaccctgacgtcactgcggctgatgaa
gtgatgaagcaagtcgctgaggagatgggcgtgggggacacgtaccactccactccagtc
ggagtgtgtttcggtggtccggcaacgaggcccggcgaatcggtgggtgacccgtacttt
ggtggcgcgggtccggagcgccacgcgtgtatccggtgcggtgagtgcatgacgggatgc
aagtacaacgcgaagaacacactggacaagaactacctgcaccttgcggaacgcaacggg
gcagaggtccggccgctcaccacggtcacggccgtaaggccattatctgaaggtgggtac
gctgtcgacactgtgcgaaccgggcgcagcacgcaccgcagaaagaacctcgctaccttt
actgccgaacaggtgattttcgcggccgggacctacaacacgcagaaacttcttcaccgc
ctgcgtgacgagggtgcgctgccagaagtatcaccgcgcctcggtgaactgacgcgcacc
aactcggaatcaattctgggcgccaaaagccgttccgccactaacgattacacccgtggt
gtcgcgatcacctcgtcattccacccggacgagcacacacacatcgaaccagtccgatac
ggcaagggcagcaacgccatgggactgctgcagaccgcgctgaccgatggtggcgagaag
attccgcgatggctgacctgggtgctgaccatgatcctgagcccccggaacctcacctgg
ttctcagtgcgccgctggtccgagaaaacgatcatcctcctggtcatgcaaaccctcgac
aactcgatcaatatccgcgggaagaaaggcttattcggaacctaccggctcacctccagc
cagggtcacggcgcaccgaaccccacctggatcccgaaaggtaatgaaaccgcacgtcga
gtgtcgaaaaagatcggtggggtccccggcggcaccatcggcgagatcgcgaacataccg
atgaccgcacacttcatcggtggctgcccgatcggagatagccgcgacaccggcgtgatc
gatccttggcaccgcatctacggccacccagggctccatgtcaccgacgggtcagcgatc
accgcgaacctcggtgtcaacccgtcactgaccatcaccgcccaggctgaacgtgcgctc
gcgttctggcccaacaagggtcaggccgacagccgtccacccgtcggatcgggttacacc
aggcttcccgccgtcgcgccacaacacccggcagtccccgaacacgcgcccgcagccctc
cacctgcccattgcggatgtcacacacggccgcgcgctgaccgctacgcccggccccaac
gctgaaaaggaactctcatga

DBGET integrated database retrieval system