KEGG   Amycolicicoccus subflavus: AS9A_2383Help
Entry
AS9A_2383         CDS       T01514                                 

Definition
FAD dependent oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
asd  Amycolicicoccus subflavus
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:asd00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2445037..2446797)
Genome map
AA seq 586 aa AA seqDB search
MTFDYDVLVIGSGFGGSVAALRLTEKGYRVGVLEAGRRFDRDTLPKTSWDLRNFLWAPKL
RCFGMQRIHMVKDAVILAASGVGGGSLVYANTLYEPLDPFFRDKQWSHITDWRSELSPYY
RQAKSMLGVQTNPDVTAADEVMKQVAEEMGVGDTYHSTPVGVCFGGPATRPGESVGDPYF
GGAGPERHACIRCGECMTGCKYNAKNTLDKNYLHLAERNGAEVRPLTTVTAVRPLSEGGY
AVDTVRTGRSTHRRKNLATFTAEQVIFAAGTYNTQKLLHRLRDEGALPEVSPRLGELTRT
NSESILGAKSRSATNDYTRGVAITSSFHPDEHTHIEPVRYGKGSNAMGLLQTALTDGGEK
IPRWLTWVLTMILSPRNLTWFSVRRWSEKTIILLVMQTLDNSINIRGKKGLFGTYRLTSS
QGHGAPNPTWIPKGNETARRVSKKIGGVPGGTIGEIANIPMTAHFIGGCPIGDSRDTGVI
DPWHRIYGHPGLHVTDGSAITANLGVNPSLTITAQAERALAFWPNKGQADSRPPVGSGYT
RLPAVAPQHPAVPEHAPAALHLPIADVTHGRALTATPGPNAEKELS
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgacctttgactatgacgttctcgtgatcggctctggattcggcggctcggtcgccgcg
ttacggctcaccgagaaaggctaccgagttggtgtgctcgaggccggacgccgattcgac
cgtgacactctccctaaaacctcatgggatctgcggaacttcctgtgggcccccaagctg
cggtgcttcggtatgcagcgcatccacatggtgaaggacgcggtaatcctcgctgcttcc
ggtgtcggcggcgggtcgctggtgtacgccaacacgttgtatgaaccactcgatcccttt
ttccgggacaagcagtggtcccatatcactgactggcgctcggaactcagtccgtactac
cggcaggccaagtccatgctcggcgtgcagaccaaccctgacgtcactgcggctgatgaa
gtgatgaagcaagtcgctgaggagatgggcgtgggggacacgtaccactccactccagtc
ggagtgtgtttcggtggtccggcaacgaggcccggcgaatcggtgggtgacccgtacttt
ggtggcgcgggtccggagcgccacgcgtgtatccggtgcggtgagtgcatgacgggatgc
aagtacaacgcgaagaacacactggacaagaactacctgcaccttgcggaacgcaacggg
gcagaggtccggccgctcaccacggtcacggccgtaaggccattatctgaaggtgggtac
gctgtcgacactgtgcgaaccgggcgcagcacgcaccgcagaaagaacctcgctaccttt
actgccgaacaggtgattttcgcggccgggacctacaacacgcagaaacttcttcaccgc
ctgcgtgacgagggtgcgctgccagaagtatcaccgcgcctcggtgaactgacgcgcacc
aactcggaatcaattctgggcgccaaaagccgttccgccactaacgattacacccgtggt
gtcgcgatcacctcgtcattccacccggacgagcacacacacatcgaaccagtccgatac
ggcaagggcagcaacgccatgggactgctgcagaccgcgctgaccgatggtggcgagaag
attccgcgatggctgacctgggtgctgaccatgatcctgagcccccggaacctcacctgg
ttctcagtgcgccgctggtccgagaaaacgatcatcctcctggtcatgcaaaccctcgac
aactcgatcaatatccgcgggaagaaaggcttattcggaacctaccggctcacctccagc
cagggtcacggcgcaccgaaccccacctggatcccgaaaggtaatgaaaccgcacgtcga
gtgtcgaaaaagatcggtggggtccccggcggcaccatcggcgagatcgcgaacataccg
atgaccgcacacttcatcggtggctgcccgatcggagatagccgcgacaccggcgtgatc
gatccttggcaccgcatctacggccacccagggctccatgtcaccgacgggtcagcgatc
accgcgaacctcggtgtcaacccgtcactgaccatcaccgcccaggctgaacgtgcgctc
gcgttctggcccaacaagggtcaggccgacagccgtccacccgtcggatcgggttacacc
aggcttcccgccgtcgcgccacaacacccggcagtccccgaacacgcgcccgcagccctc
cacctgcccattgcggatgtcacacacggccgcgcgctgaccgctacgcccggccccaac
gctgaaaaggaactctcatga

DBGET integrated database retrieval system