KEGG   Amycolicicoccus subflavus: AS9A_2485Help
Entry
AS9A_2485         CDS       T01514                                 

Definition
hypothetical protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
asd  Amycolicicoccus subflavus
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:asd00903]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2543333..2543812
Genome map
AA seq 159 aa AA seqDB search
MTSTNTGTVVEFLAALRDRNYEQALSFVADDVVWHNVSLPKVRGKSRLRQAFVMMDKLAI
RFDVQFRNISGDDRAVLTERTDALSLGRLRTEFWVCGTFEFREGKIAVWRDYFDYANMSG
ALLRGVLGVVLPRREPLSLFASEGIFQKAADPGRDRARD
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtaccaacacgggcacggtggttgagtttcttgccgccctccgcgatcgcaat
tatgagcaggcattgagctttgtagcggacgatgtcgtgtggcacaacgtttctctgcct
aaggttcgtggcaaatcgcgccttaggcaggcgttcgtgatgatggacaaacttgccatc
cggtttgatgtccagttccgcaacatcagcggcgacgatcgagcggtgctgacggagcgc
accgatgctctgagcctgggtcggctgcgcaccgaattttgggtatgcggaacgttcgag
ttccgggagggaaagattgctgtctggcgtgactactttgactacgcgaacatgagcggt
gcactgctacgcggtgtgctcggcgtggtgctgccgcgtcgcgagccacttagcctcttc
gcttccgaaggcatcttccagaaggccgcggatccggggcgcgatcgcgcacgggactga

DBGET integrated database retrieval system