KEGG   Amycolicicoccus subflavus: AS9A_2575Help
Entry
AS9A_2575         CDS       T01514                                 

Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
asd  Amycolicicoccus subflavus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AS9A_2575
   01230 Biosynthesis of amino acids
    AS9A_2575
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AS9A_2575
   00030 Pentose phosphate pathway
    AS9A_2575
   00051 Fructose and mannose metabolism
    AS9A_2575
   00052 Galactose metabolism
    AS9A_2575
  Energy metabolism
   00680 Methane metabolism
    AS9A_2575
Enzymes [BR:asd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AS9A_2575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2622395..2623318)
Genome map
AA seq 307 aa AA seqDB search
MASIVTLTLNPALDVDTTTKEVRPTSKLRCGPARYDAGGGGINVARVAHTLGESACAVYP
AGGPVGNALQEILAGAGIGTRCINIQGATREGITVNETSTGKQYRFVLPGPELAITEQDE
CLAAVAEECEQADFVVASGSLPPGVDSEYYSRVVAVARDAGAQVILDTSGDALRDAAGVF
LVKPNLGELARLTGRSLEDEEGRAAAARSLIESGRAENVVISLGAEGAMLVTADDVAVLP
PIEVPIRSAVGAGDTMVAGITVGLSRGWEMVRAVQLGVAAASATLITEGTGLCRRADVDR
LFGEYTD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggccagcattgtcactctgacactgaacccggcacttgacgtcgacacgacaacaaag
gaagtgcgcccgaccagcaagctacgctgcgggcccgcgagatatgacgccggcgggggc
ggcataaatgtcgctcgtgtcgcacacactctcggtgaatcggcgtgcgctgtttaccca
gctggcggacccgtcggcaacgcgcttcaagagatcctcgccggggcgggcattggaacg
aggtgcatcaacattcagggcgcgacgagggaaggcattacggtcaacgagacatcaacc
ggcaagcagtaccgtttcgtactgccaggccccgagctggcgatcactgaacaggatgag
tgtctggcggctgttgccgaggaatgcgagcaggccgatttcgtagtcgcgagcggcagt
ttgccgccaggcgtggattcggagtactactcgcgggtggtggccgttgcgcgcgatgcg
ggggcccaggtcatcctcgacacgtctggtgatgccctgcgtgacgccgcaggagttttt
ctggtgaagcccaatctcggtgaactggcgcgactcacggggcgttccctggaagacgag
gagggccgcgccgccgccgcccgcagccttattgagagcggacgagccgagaacgtcgtg
atttcgctcggcgccgagggtgcaatgctggtcaccgccgacgacgtggcggtgctgcca
cctattgaggtgccgatccgaagcgcggtgggagcgggagacacgatggttgcgggtatc
actgtggggctgtcgcgcggatgggagatggtgcgcgccgtgcagctcggggttgccgcg
gcgtcggctacgttgatcaccgaaggcaccggcctctgccgtcgcgcagatgttgatcgg
ctgttcggtgaatacaccgattga

DBGET integrated database retrieval system