KEGG   Amycolicicoccus subflavus: AS9A_2965Help
Entry
AS9A_2965         CDS       T01514                                 

Definition
putative exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
asd  Amycolicicoccus subflavus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:asd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3032669..3034522
Genome map
AA seq 617 aa AA seqDB search
MTVSTVLNAQGLLHVFNEAGILAPADVHVAQRLQKLGGESSEIVLLAAALATRAVRLGSV
CVDLNRLSEVTVESEIDLDGLPWPDSADVGAALKRSPLLGSAEYPLQPLRLVATTEGELL
YLERYYQQEQTIRRILDQRALSHPTVDAAQVTNILGGLFRTEEGVATAPPDRQRIAAALA
ATHWTTVVAGGPGTGKTHTVARILAVLHALHGEGLRVGLAAPTGKAAARLEESINQQAAP
LGLPAGLSAMTLHRLLGWRPGSRHRFRHDEYNRLPYDVVVLDETSMVSLTMMCRLLEAVR
PDARLLLVGDPDQLTSVEAGAVLADLVARPASSGASPSPQLEPLIRADLDATDDPDEAAL
SPFEKQRLHRGVIRLSRGRRFGGNISVLATAVRDGRADDVLEILHTSFDDVSFCPPGELT
SLRHDIVAASAALTARATAGDVPGALKTLESHRLLCAHRDGPFGVRQWAQQAMDWISADT
GERLDPFRWYPGQPLLVTENDHDAKVYNGDTGVVVAHGEGVVAAFQRGENPILLHPNQLA
AVQTVYAMTIHRSQGSQYDTVSVLLPDDASALLTRELLYTAITRARHHVRIIGTDVSVAA
GVARQVQRASGLRRTLV
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcagtaccgttctcaacgcccagggcttactccacgtcttcaatgaggcaggc
atcctcgctccggcggacgtgcacgtcgcccagcggctgcagaagcttggtggcgaatca
tccgagatcgtgctcctcgctgcagctctcgccacgcgcgcggtgcggctcggctccgtg
tgtgtcgacctcaatcggctctcggaagtcactgtcgagtccgaaattgatctagacgga
ctgccgtggccggacagcgccgacgttggcgcagccctgaaacgaagccccctcctcggg
agcgccgagtatccacttcagccgctgcggctcgtcgcgacaaccgaaggggaacttctc
tatctcgagcggtactaccagcaagagcaaaccatccgccgcatccttgaccagcgcgcg
ctgagccatcccacggttgacgccgcgcaggtcaccaacatcctgggcgggttgttccgc
accgaggagggcgtcgccactgcaccgccggaccggcagcgcatcgccgcggcactagcg
gcgacacactggaccaccgtcgtagcgggaggccccggcacgggtaaaacccacaccgtc
gcacgtattctcgccgtgctgcatgcgctgcacggtgaaggcctgcgcgtcggacttgcc
gccccgaccggcaaagctgctgcgcgccttgaagaatcgatcaatcagcaggctgctccg
ctcgggctccccgcagggctctccgcgatgactttgcaccggctgctcggctggcggccc
ggcagtcggcaccgcttccggcacgatgagtacaaccggctgccttacgacgtggtggtg
ctcgacgaaacgtcgatggtgtcgctgacgatgatgtgccgcctcctcgaagcggtccgg
ccggacgcccgcttgctgctcgtgggcgaccccgaccagttgacgtccgtcgaagccggg
gccgttcttgctgaccttgttgcccggccagccagctcaggcgcgtcacccagcccgcaa
ctcgagccgctgatccgcgctgacctcgacgccaccgacgatcctgacgaagccgctctc
agcccgttcgagaagcagcgcttgcaccggggcgtcatccggctcagccgcggccggagg
tttggcggcaacatctccgtactcgcaacagcggtgcgagatggccgcgctgacgacgtt
ctcgaaattctgcacaccagcttcgacgacgtgtcattctgcccgcctggtgaactcacg
tcgctccgtcatgacatcgtcgccgcctccgcagcgctgaccgcgcgcgccacggctggt
gatgtgcccggcgcattgaagacactcgaatcgcatcggctgctgtgtgcgcaccgtgat
gggccgttcggtgtccggcaatgggctcagcaggccatggactggatcagtgcagacacg
ggtgaacggctcgaccccttccgctggtacccagggcagcccctgctggtcacggagaac
gatcatgacgcgaaggtatacaacggcgataccggggtggtggttgcgcacggcgagggg
gtggtggcggcgttccagcgcggagagaacccgattctgttgcaccccaaccagcttgca
gcggtacagacggtgtacgcaatgacaattcaccgcagtcagggcagccagtacgacact
gtcagcgtccttctgcctgacgacgcgtccgcgctgctgacgcgcgaactcctgtacacc
gccatcactcgggcacggcaccacgtccggatcatcggtaccgacgtctctgtcgcggcg
ggtgtcgcccggcaggtacaaagggccagcgggctgcggcggacgctcgtgtag

DBGET integrated database retrieval system