KEGG   Amycolicicoccus subflavus: AS9A_3036Help
Entry
AS9A_3036         CDS       T01514                                 

Definition
(GenBank) putative acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
asd  Amycolicicoccus subflavus
Pathway
asd00010  Glycolysis / Gluconeogenesis
asd00620  Pyruvate metabolism
asd00640  Propanoate metabolism
asd00680  Methane metabolism
asd01100  Metabolic pathways
asd01110  Biosynthesis of secondary metabolites
asd01120  Microbial metabolism in diverse environments
asd01130  Biosynthesis of antibiotics
asd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AS9A_3036
   00620 Pyruvate metabolism
    AS9A_3036
   00640 Propanoate metabolism
    AS9A_3036
  Energy metabolism
   00680 Methane metabolism
    AS9A_3036
Enzymes [BR:asd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AS9A_3036
Lipid biosynthesis proteins [BR:asd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AS9A_3036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEF41483
UniProt: F6ELN5
Position
complement(3109831..3111471)
Genome map
AA seq 546 aa AA seqDB search
MSSESTARTDQATRVQALLDRYDLPDACAAQLLCDDHPAEAVAFTVIEADLSSTDLTFGD
LRDQSTRFAAALADLGVEPGDYVATLMGKSADLVVALLGIWRRGAVHVPLFTAFAPPAIG
FRLQASGAKVVVADADQVAKLAPGEDIPADASWQVVVAGGDTAAGLNFNELLTAHTPDDP
RGDAVAVGANGVLVQLFTSGTTGTPKGVPVPVRALASFHAYLEFGLDVRDDDVFWNAADP
GWAYGLYYALLAPMAAGVRSLLLHAGFSAPLTWQVMEQFGVTNFAAAPTVYRSLRADTTP
VPQSISLRRASSAGEPLTPDVVAWSEQTLGAVVRDQYGQTEHGMFIVNAWADGLREDVPA
GSMGKPLPGWSCAVLSEDSDVLAAPGVPGRVAIDTHASPLMWFTGYVDAPEKTAQRFTED
GRWYLTGDAGQVDEDGFFFFSARDDDVIIMAGYRIGPFDVESVLVMHDDVVEAAVVGMPD
ELRGEVLEAFVVLREGAEATDGLATELQQLVKRKFAAHAYPRTVHFVQQLPKTPSGKVQR
YVLRQG
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgagctccgagagcaccgcacgtactgatcaggcgacacgggtacaggccttgctggac
cgctacgacctccctgatgcgtgtgctgcgcaacttttgtgcgacgaccacccggcggag
gctgtcgcgttcacagtgatcgaggctgacctcagttcgacggacctcactttcggcgac
ctgcgcgaccagtccactcgtttcgcggcggccctggctgatctgggtgtcgagcctggc
gattacgttgccacgttgatgggcaagtccgctgacctggtggtagccctccttgggatc
tggcgacgcggcgccgtgcacgtaccgctgtttactgcgttcgcgcctccagctattggg
ttccggcttcaggcaagcggagcgaaggtcgtggttgctgacgctgaccaggttgccaaa
ctcgctccgggcgaagacattccggctgatgcgtcgtggcaggttgtcgtcgccggcggt
gatacggcagcggggctgaacttcaacgagttgctcaccgcgcacaccccggacgatccg
cgcggtgacgctgtcgctgtcggggcgaatggtgttctcgtgcagctcttcacctcgggc
acgacgggcacgcccaaaggtgtgccggtgccggtgcgggctctcgcgtcgttccacgcg
tacctcgagttcggcctggacgtgcgtgacgacgacgtcttctggaacgctgcggaccca
gggtgggcgtacgggctttactacgcgctgttagcgccaatggccgctggggtgcgcagt
ctgctactccacgcagggttctccgcgccactcacgtggcaggtgatggagcagttcggt
gtcaccaatttcgcggccgcgccgaccgtgtaccgcagcctccgtgctgacacaacgccg
gtgccgcaatcgatttcgctgcgccgcgcttcctccgccggtgaaccactcacgccggac
gtggtggcctggtcggagcaaactctcggcgccgtagttcgcgaccagtatgggcaaact
gaacacgggatgttcatcgtcaacgcgtgggcggatgggctgcgcgaggacgtcccggcc
gggtcgatgggcaagccgctgcctggctggtcgtgcgcagtgctttccgaggactcggac
gtgctcgctgcgcctggcgtaccaggccgcgtagccatcgacacccatgccagcccgctg
atgtggttcaccggctatgtcgatgccccggagaaaaccgctcagcgattcacggaggac
ggccgctggtacctgactggcgacgctggccaggttgacgaggacgggttcttcttcttt
tccgcccgcgatgacgacgtaatcatcatggccggttaccgcatcggcccgttcgacgtt
gaaagcgtcctggtcatgcatgacgatgtcgtcgaggccgccgttgtggggatgcccgat
gagctgcggggcgaagtgcttgaagccttcgttgtgctgcgcgaaggcgccgaggccacg
gacggactcgcgaccgagctgcagcagctagtcaaacgtaagttcgctgcgcatgcgtac
ccgcgtacggtgcatttcgtgcaacaactgccgaaaacacctagtggcaaggttcagcgg
tacgtcctgcggcagggttag

DBGET integrated database retrieval system