KEGG   Amycolicicoccus subflavus: AS9A_3225Help
Entry
AS9A_3225         CDS       T01514                                 

Definition
putative glucosyltransferase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
asd  Amycolicicoccus subflavus
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AS9A_3225
Enzymes [BR:asd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     AS9A_3225
Glycosyltransferases [BR:asd01003]
 Polysaccharide
  Storage polysaccharide
   AS9A_3225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3303211..3304440
Genome map
AA seq 409 aa AA seqDB search
MKILIISWEYPPVVVGGLGRHVHNLAVHLAEAGHDVVVLSRQPSGTDASTHPTSDTSTEG
VRVVAVAEDPPHLVFGEDMIAWTLAMGHAMVRAGLQLSEDWQPDVIHAHDWLVAHASVAL
SEHLDVPLVATIHATEAGRHSGWVSGRINRQVHSVEWWLANAADALITCSTSMRDEVCAL
FGPALSPVTVIHNGIDTATWAYQPRVPHGGPARLFYAGRLEYEKGVQDAIKALREVRKTH
PGTTLTIAGSGTQLEWLMQCAREARVARAVKFAGPLDHDGLLDWLYTADAILLPSRYEPF
GIVALEAAATGAPLITSTAGGLGEAVIDGVTGRTFAPGDTAALTSCIRNALDEPELTQHM
AEAARRRLTREFDWSSVSFATSEVYKTTSKRPHRTLARPTIVERPLPGR
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcctcatcatctcctgggagtatccgcccgtcgtcgtgggcggcctcggacgg
catgtccataacctggcggttcaccttgccgaagccggtcatgacgtcgtcgtgctgtcg
cgccagccttccggaactgacgcgtcaacgcaccccacttccgacacgagcaccgaaggt
gtccgggtcgtcgcggtcgccgaagacccgccccatctggtctttggcgaagacatgatc
gcctggaccctcgccatggggcacgcgatggtccgtgcgggcctgcagctgagcgaagat
tggcaacccgacgtgatccacgcgcacgactggctcgtcgcacacgcgtcggtcgcgctg
agtgaacacctcgacgttccactcgtcgcgacgatccacgcaacagaggcaggacggcac
agcggctgggtgtcgggccgaatcaacaggcaagtccattcggtcgagtggtggctggcg
aacgctgcagatgcgcttatcacgtgctcgacgtcgatgcgagacgaagtgtgtgcgctg
ttcgggcccgctctctcgcccgtgaccgtcatccacaacggcatagacacggctacatgg
gcttatcagccgcgggtaccgcacggcggccccgctcgcttgttttatgcaggcaggctg
gaatacgagaaaggcgttcaggacgcgatcaaggccttgcgggaggtccggaaaactcac
cccggcacgaccctgacgatcgcgggctccgggacgcaactcgagtggctcatgcaatgc
gcccgcgaggcgcgcgtggcccgagccgtcaaattcgccggacctcttgatcatgacggg
cttctggactggctctacacagccgatgcgatcctgctgcccagccgttacgagccgttc
ggcattgtcgctctggaggcggcagccaccggggcaccgctcatcacctcgaccgctggc
ggcctcggagaggcggtgatcgacggggtgaccggccggacgttcgctccgggcgataca
gcagcgctgacaagctgcatccggaatgcactcgatgagcccgaactaactcagcatatg
gccgaggccgcgcgcagacgtctcacccgggaattcgactggtcctcggtttcatttgct
acatctgaggtatacaagacgacgagcaaacgtccacaccggaccctggcgcgccccact
atcgtcgagcgcccattgccaggacgctga

DBGET integrated database retrieval system