KEGG   Amycolicicoccus subflavus: AS9A_3270Help
Entry
AS9A_3270         CDS       T01514                                 

Gene name
thrC
Definition
(RefSeq) Threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
asd  Amycolicicoccus subflavus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AS9A_3270 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AS9A_3270 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AS9A_3270 (thrC)
Enzymes [BR:asd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AS9A_3270 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3352075..3353157)
Genome map
AA seq 360 aa AA seqDB search
MPRQNPVHRAWPGLIEAYRDRLAVGGDWTPVTLQEGATPLIPAEYLSELTGCEVYLKVEG
LNPTGSFKDRGMTMAVTDAVARGQRAVLCASTGNTSASAAAYAAKAGITCAVLIPAGKIA
MGKLAQSVIYGAKIIQVNGNFDDCLELARKATAEFPQIALVNSVNPARIEGQKTAAFEVC
DVLGRAPDVHALPVGNAGNITAYWRGYSEYFSDGITASKPRMLGVQAAGAAPLVKGEPVK
NPETIATAIRIGAPASWEGAMTARNESGGQFRAATDDEILDAYRLLASREGVFVEPASAA
SVAGLLAAHAEGWVEAGSTVVCTVTGNGLKDPDTALHGIPEVEAIPVDPVSVARALGLAE
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgccccgccagaacccagtgcaccgcgcgtggccagggctcatcgaggcttaccgggac
cggctcgctgtcggcggggactggaccccggttaccttgcaggagggggcaacccccctg
ataccggccgagtatctctcagagctgactggctgtgaggtgtacttgaaggtcgagggg
ctgaatccgaccggctcattcaaggaccggggcatgacgatggcggtaacggacgcggtc
gcgcgcggtcagcgcgcggtgctctgcgcctcgaccgggaacacctctgcttcggcagcg
gcatacgccgcaaaggcggggattacctgcgctgtattgattccggcggggaaaatagcg
atggggaagctcgcccagtcagtgatctacggggcaaaaatcattcaggtcaacggcaac
ttcgacgattgcctggaactcgcgcgaaaagcgacggctgagtttccgcagatcgctctg
gtcaactcagtcaatcctgcccgcattgaaggtcagaagacggccgcgttcgaggtgtgc
gacgtcctgggacgagcgcccgatgtgcatgcgctgccggtgggcaacgcgggcaacatc
actgcttactggcgtgggtactctgagtacttttccgacggcatcaccgcctccaagccc
aggatgctgggtgtgcaggcagctggagccgccccgctcgtcaagggtgaaccggttaag
aatcccgaaactattgcaacagccatccgcatcggtgcgccagcctcatgggaaggggct
atgaccgcccggaacgaatccggtgggcagttccgggccgcaacagatgacgagattctg
gacgcataccggctgctggcctctcgcgaaggagttttcgttgagccagcctccgctgcg
agcgtggcaggtttgctggcggcgcacgccgaaggctgggttgaagcgggatcgactgtg
gtctgcactgtcacgggaaatggtctgaaagaccccgacacggctttgcacgggattccg
gaggttgaagcgatcccagttgatccagtatcagtagcgcgcgctctcggtctggcagaa
tga

DBGET integrated database retrieval system