KEGG   Amycolicicoccus subflavus: AS9A_3353Help
Entry
AS9A_3353         CDS       T01514                                 

Gene name
folP2
Definition
putative dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
asd  Amycolicicoccus subflavus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:asd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3427881..3428624)
Genome map
AA seq 247 aa AA seqDB search
MEAVRRSVNEGADVIDIGGVKAGPGQDVDEAEEMRRVVPFVAAVRNTFPDVIISIDTWRA
NVARRACAEGADLINDTWAGADPELAVVAAELGAGIVCSHTGGAEPRTRPHRVRYADIAA
EVADEVTRAADRALSAGVREDGILIDPTHDFGKNTFHGLDLLRRLDVLVNSGWPVLMALS
NKDFIGETLDVGLTERLEGTLAATAVAAWSGARMFRVHEVAQTRRVLDMVAAIAGTRPPA
RTVRGLA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggaagcggtccgtcggtcggtcaatgagggagccgatgtcatcgacattggcggagtg
aaggcaggtcccggacaggacgtcgacgaagcggaggaaatgcggcgcgtagtgccgttc
gtcgctgcggtcaggaacaccttcccagacgtcatcatcagcatcgatacctggcgcgcg
aacgtagcccgcagggcatgcgcggagggcgcggatctgattaacgacacgtgggcgggt
gctgatcccgaacttgcggtcgttgctgctgagcttggtgcgggaatagtgtgctcgcac
acgggaggcgccgaaccgcgcacgagaccccaccgcgtgcgctatgccgacattgccgcg
gaagtagctgacgaagtgacccgcgctgccgatcgagcgctatcagctggcgtccgtgaa
gacggtatcctgatcgatccgacacacgatttcggcaaaaacactttccacggcctcgat
ttgttgcggcgattggacgttcttgtgaattccggatggccagtcttgatggcgctgagc
aataaggatttcatcggggagactctagatgtgggtctgaccgaaagattggagggcacc
ttggcagcaacagctgtagcagcctggtctggtgcgcgaatgttccgggtgcatgaggtg
gcccaaactcggcgtgttctcgacatggtggctgcaatagcaggaacacgtccacccgcc
cgaacagtgaggggtctcgcatga

DBGET integrated database retrieval system