KEGG   Amycolicicoccus subflavus: AS9A_3499Help
Entry
AS9A_3499         CDS       T01514                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
asd  Amycolicicoccus subflavus
Pathway
asd00900  Terpenoid backbone biosynthesis
asd01100  Metabolic pathways
asd01110  Biosynthesis of secondary metabolites
asd01130  Biosynthesis of antibiotics
Module
asd_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AS9A_3499 (ispE)
Enzymes [BR:asd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     AS9A_3499 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: AEF41939
UniProt: F6EQR2
Position
complement(3571392..3572360)
Genome map
AA seq 322 aa AA seqDB search
MLHVVDEPVKVRAPAKVNLHLAVGDLRDDGYHELTTVFQALSLYDEVAVTRGDALTVSVK
GEGAREVPLDENNLVWRAAQLMAEKAGRSPRIHIAIRKGIPVAGGLAGGSADAAATLVAL
NTLWHLELSRGELSDLAAELGSDVPFSLRGGTAMGIGRGEQLLPVLSRSTYHWVLAFANG
GLSTPAVYKELDRLRESGTRPRLGSADDLMHALTVGDPDALAPLLGNDLQAAAISLKPQL
RRTLRAGKDAGALAAIVSGSGPTCAFLCRDAEDAVSVGVEVSATGVCRTVRTATGPVPGA
RVIDTDSGPDDPAQERAVDGGA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcatgtcgttgacgaaccggtgaaggtccgcgcgcccgccaaggtaaatctgcac
ctggcggtcggcgatcttcgcgacgacggataccacgagctaacaacagtttttcaggca
ctttcgctgtacgacgaagtcgccgtgacgcggggcgatgcgctaaccgtctcagtaaaa
ggcgaaggtgcccgcgaagtccccctagacgagaacaacctggtgtggcgggctgcacag
ctgatggccgagaaagcgggccggtcgccgcgaatccacatcgcgataagaaaaggaatc
cctgtagcgggaggccttgccggcggcagtgcggacgcggctgcgacccttgtcgccctc
aacacgctgtggcatctcgaactcagccgcggcgagctatctgacctcgctgccgagctc
ggcagcgatgttccgttctcgctgcgcggcggtaccgcgatgggaattgggcgcggcgag
cagctgttaccggttctttcacggagtacttaccactgggtgctggccttcgcgaacggt
ggcctgagcacccccgcggtgtacaaggaactcgatcgactgcgggaatccggcacacgc
ccacgtctgggaagcgccgacgatttgatgcacgcgctgaccgtcggggaccctgatgcg
ctcgcaccgctgctcggcaacgatctgcaagcagctgcgatttcgctgaaaccgcagctt
cggagaacgttgcgagccggaaaggacgcgggcgcgctggctgcaattgtgtcgggttca
ggaccgacgtgcgcgtttttgtgccgtgacgctgaggatgcggtcagcgttggggtcgaa
gtttcggcaactggagtgtgcagaacagttcgtacggcgaccggaccggttccaggtgcg
cgggtgatcgacaccgacagcggccccgatgatccggcccaagagcgcgctgtcgatggg
ggtgcgtga

DBGET integrated database retrieval system