KEGG   Amycolicicoccus subflavus: AS9A_3511Help
Entry
AS9A_3511         CDS       T01514                                 

Definition
arsenate reductase
Orthology
K00537  
arsenate reductase [EC:1.20.4.1]
Organism
asd  Amycolicicoccus subflavus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3584644..3584994
Genome map
AA seq 116 aa AA seqDB search
MSDVTIYHNPRCTTSRNVLAIIRDAGIEPEIVKYLDTPPGRDALASMITAASLTPRQAIR
KREKLYKELGLDNPDTSDDALLDAMAEHPILIERPIVVTPRGVRLARPPHTVEEIL
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgtgacgatctaccacaacccccggtgcacgacgtcccggaatgtcctcgcg
attatccgagacgccggcatcgaacccgaaatcgtcaaatacctcgacaccccaccggga
cgcgacgctctcgcttcgatgatcaccgcggcgtcgctcacaccccggcaggccatccgc
aagcgcgaaaagctgtacaaagaactcgggctcgacaacccggacaccagcgacgacgcg
ttgctcgatgcaatggcagaacacccaatcctgatcgagcggcccatcgtcgtcacaccg
cggggcgttcgcctggcccgtccgccacacacagttgaggagatcctgtag

DBGET integrated database retrieval system