KEGG   Amycolicicoccus subflavus: AS9A_3557Help
Entry
AS9A_3557         CDS       T01514                                 

Gene name
galU2
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
asd  Amycolicicoccus subflavus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AS9A_3557 (galU2)
   00052 Galactose metabolism
    AS9A_3557 (galU2)
   00500 Starch and sucrose metabolism
    AS9A_3557 (galU2)
   00520 Amino sugar and nucleotide sugar metabolism
    AS9A_3557 (galU2)
Enzymes [BR:asd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     AS9A_3557 (galU2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3629800..3630768)
Genome map
AA seq 322 aa AA seqDB search
MTEANGQLVPPFRTAIVPAAGLGTRFLPVTKTVPKELLPLVDTPAIELVASEAAEAGAGR
LVIITSEGKEGVLAHFVRHEILEGTLERRGKHALLDKVRRAPALMDVEAVVQEEPLGLGH
AIACAEAALDDDEKEIAILLPDDLVLPTGVLSQMAEVRARYGGSVLCAIEVDPKEVSAYG
VFAVEATGDPAEAGQVMRVTAMVEKPPVDQAPSNLAAAGRYLLDREIFDALRRITPGRGG
ELQLTDAIELLVEDGHPVHVFVHKGTRHDLGNPGGFLKAAVDFALDDEEYGPDLRTWIAE
RLGLNVPDGDASAQSGVTAAGR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgactgaggccaatgggcagttggtaccgccgttccgcacggcgatcgttcctgctgcc
gggctcgggacgcggttcttgccggtcaccaagaccgtcccgaaagagcttttgccgttg
gtcgatacaccagcaatcgagctggtagcgagtgaagccgcggaagcgggtgccggtcgc
ctggtgatcatcacttccgaaggtaaagaaggcgtcctcgcgcacttcgttcggcacgag
atcctcgaaggcacattggagcggcgcggcaagcacgcgctgctcgacaaggtacgccgc
gctcctgcgctgatggacgtcgaagccgtcgttcaggaagagccgctcgggcttggtcac
gctattgcgtgtgccgaagcagcactcgatgacgacgagaaagaaatcgccatcctcttg
cctgacgacctggtacttcccactggtgtgctctcccagatggccgaagttcgcgctcgg
tacgggggcagcgtcctctgcgctatcgaagtggatccgaaggaagtcagcgcttacggt
gttttcgccgtcgaagcgaccggcgatcccgcggaagccggccaagtgatgcgcgtcact
gcaatggtggagaagcctcccgtcgatcaagctccgtcgaatctcgctgccgcgggccgc
tacctgctcgaccgcgagatctttgacgctctgcgccggatcaccccaggacggggaggc
gaactccagctcaccgacgcgattgagcttctcgtcgaagacggccaccccgtgcatgtt
tttgtccacaagggaacccgacacgacctcggaaatcccggcgggttcctcaaggctgcg
gttgactttgcactcgacgatgaggagtacggcccagacctccgcacgtggattgcggag
cgtctcgggctgaacgttcccgacggtgacgcgtccgcgcagagcggagtcacggcagcg
gggaggtga

DBGET integrated database retrieval system