KEGG   Amycolicicoccus subflavus: AS9A_3633Help
Entry
AS9A_3633         CDS       T01514                                 

Definition
putative nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
asd  Amycolicicoccus subflavus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AS9A_3633
Enzymes [BR:asd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     AS9A_3633
    3.5.1.-  
     AS9A_3633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3708339..3708941
Genome map
AA seq 200 aa AA seqDB search
MTRETKKALIVVDVQNDFCEGGSLAVAGGAAIAGEISSLVTDTLETEIGYDTIVATRDYH
IDPGDHFSDNPDFVDSWPVHCKVGTEGAEFHPDLDLQHVEAVFSKGAYTAAYSGFEGATA
DGKSLADWLRQHGVEAVDIVGIATDHCVRATALDAAREGFAARVLLDYTVGVSPETIDRA
LTELRDNGVTTAGSVGGSLK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcgaaacgaagaaggcgctcatcgtcgtcgacgtccagaatgacttctgtgag
ggcggctcgctcgccgtggctggcggggcggcgatcgcgggcgagatctcgtccctcgtc
accgacaccctcgagaccgaaattggctacgacaccatcgtcgctacccgcgactatcac
atcgaccctggcgaccacttctctgacaacccggattttgtcgacagctggccggtgcac
tgcaaggtcggcaccgagggagcagaattccacccggatcttgacctgcagcatgtcgaa
gcagtcttctcgaagggcgcgtacacggctgcctactcaggcttcgaaggggcgacagct
gacggcaagtcgttagccgactggttacgtcagcacggcgtggaagctgtcgacatcgtc
ggcattgcgacagatcactgcgtgcgagccaccgcgctcgacgcggcgcgcgaagggttc
gccgcacgtgtcctgctcgactacaccgtcggggtcagcccggaaacaatcgatcgtgcc
ctgaccgaactccgcgacaacggtgtaaccacagccgggtccgttggtggctcgctgaag
tag

DBGET integrated database retrieval system