KEGG   Amycolicicoccus subflavus: AS9A_3640Help
Entry
AS9A_3640         CDS       T01514                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
asd  Amycolicicoccus subflavus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AS9A_3640
   00670 One carbon pool by folate
    AS9A_3640
Enzymes [BR:asd01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     AS9A_3640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3716307..3716717)
Genome map
AA seq 136 aa AA seqDB search
MAHFRDTTQGCPVIMGRSTWDSLKPKFRPLPGRDNIVVTRQSDWAAEGAIVAHSLPEAFE
EANRKAWVMGGSQIYAEALPYASLAVVTEVDIDVPGDAFAPELDDSWTLESADPAKGWHT
STNGHRYRYLRYVRPV
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcccatttccgggacaccacccagggctgtcccgtgatcatggggcggtcgacgtgg
gactcgctcaagcccaagttccggcccctcccgggccgcgacaacatcgtcgtcacgaga
cagtcggactgggcagctgagggcgccatcgtggcgcactcgttgccggaggctttcgag
gaagcgaaccgcaaagcctgggtgatgggcggctcgcaaatttacgcggaggcgttgccg
tacgcgagcctggctgtcgtcaccgaagtcgatatcgacgtaccgggtgacgcgttcgcc
ccggagctcgacgattcgtggacgctcgaatcggccgatccagcgaagggctggcatacc
tcaacgaacggccaccggtaccgctacctccgctacgtcagaccggtctga

DBGET integrated database retrieval system