KEGG   Amycolicicoccus subflavus: AS9A_3652Help
Entry
AS9A_3652         CDS       T01514                                 

Definition
zinc-binding alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
asd  Amycolicicoccus subflavus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    AS9A_3652
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AS9A_3652
  Lipid metabolism
   00071 Fatty acid degradation
    AS9A_3652
  Amino acid metabolism
   00350 Tyrosine metabolism
    AS9A_3652
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AS9A_3652
   00626 Naphthalene degradation
    AS9A_3652
Enzymes [BR:asd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AS9A_3652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3727288..3728301
Genome map
AA seq 337 aa AA seqDB search
MKAAVVHGFHTPVSIEDRPIPDVGPHEVLVRVEASGLCHTDIHAANGDWPVKPTPPFIPG
HEGVGIIERAGANITRVAVGDRVAVPWLGTACGECEYCITGWETLCEKQQNTGYSIDGGW
ADYVVADGRYVVKVPEGVDPFEAAPLTCAGVTTYKAVKVSGARSSDLVAIFGIGGLGHLA
LQYAQIAGARVVAVDLVDEKLEMARELGATYTVNARETDPVEYIKSLGGADAAIALAVNP
KSFEQAYGSLKRGGTLVLVGLPAENQMNLPIFETVLNGITVVGSIVGTRADLQEVFELHA
AGKTSVRYHTRKLDEVNDAIRDVEQGKIDARLVFDMS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagttgtccacggcttccacacacctgtcagcatcgaggatcggccgatt
cccgacgtgggcccccacgaagtcctcgtgcgcgtcgaggcctcgggcctctgccacacc
gatatccacgcagcgaacggagactggccagtaaagcccacaccgcctttcattcccggc
cacgagggtgtaggaatcattgagcgcgctggcgcgaacatcacgcgggtggcagtcggt
gatcgtgttgccgtgccgtggctcggcacggcgtgcggcgaatgcgaatactgcatcacg
gggtgggaaacgctatgcgagaagcagcagaacaccggctactccatcgacggcgggtgg
gcggactatgtcgtcgctgatggcagatacgttgtgaaagtcccagagggcgttgacccc
ttcgaggcggcaccgctgacgtgcgcgggcgttaccacctacaaagcggtgaaggtttcg
ggtgcgcgttcctcggacctcgtcgcgattttcgggatcggcggcctcgggcacctcgcg
ctccaatatgcccagatcgcgggtgcccgcgttgtcgcagtcgatctcgtcgatgaaaag
ttggagatggcgcgggaacttggcgcaacctataccgtcaacgcacgcgaaaccgatccc
gtcgagtacatcaaaagcctgggtggcgcggacgcggcgatagccctcgccgtgaatccc
aaatctttcgagcaggcgtacggctcgctcaagcggggcggcactctggtgcttgtcggt
ttgccagctgaaaaccagatgaacctaccgatcttcgagaccgtcctcaacggcatcacc
gttgtcggctcgatcgtgggcacacgcgctgacctgcaagaagtattcgagctccacgcg
gcaggtaagacgtcggttcgttaccacacgcgcaagctcgacgaagtcaacgacgcgatt
cgcgacgtcgagcaaggcaagatcgatgcccgtctggtgttcgacatgtcgtga

DBGET integrated database retrieval system