KEGG   Amycolicicoccus subflavus: AS9A_3845Help
Entry
AS9A_3845         CDS       T01514                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
asd  Amycolicicoccus subflavus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AS9A_3845
Enzymes [BR:asd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     AS9A_3845
Exosome [BR:asd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AS9A_3845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3914073..3915578
Genome map
AA seq 501 aa AA seqDB search
MTVTRYVAAIDQGTTSSRCIVFDHSGRIVSVSQKEHEQIFPRAGWVEHDPAEIWSNVREV
VGAAIGKADIPKDSIAAVGITNQRETTVVWERATGKPIYNAIVWQDTRTEELCREIAGSQ
GPDLYRERTGLPLSTYFSGPKIRWILDEVDGARERAERGELCFGTMDTWVLWNATGGPDG
GVHVTDVTNASRTLLMDLTTLEWDEAICADIGVPIAMLPEIRSSSEVYGSARPKRGLDGV
PIAGILGDQQAATFGQACLSPGEAKNTYGTGNFLLLNTGTSPVQSENGLLTTVCYRLGSA
DPVYALEGSIAVTGSLVQWLRDNLGLISSAAEVESLARSVDDNGGVYFVPAFSGLFAPRW
RPDARGVIAGLTRFHNKGHIARAALEATAYQTREVLEAARADSGVDLTTLKVDGGMVSNE
LLMQFQADMLDVPVIRPVVSETTALGAAYAAGLAVGFWDDVEDIRSNWAQDKAWQPSMDA
RKRARLYADWNKAVERTYGWV
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
gtgactgtgacccgctacgttgccgctatcgaccagggcacgacctcgagccgctgtatt
gtcttcgaccactccggacgaatcgtgtcggtgtcccagaaggaacacgaacagatcttt
ccccgtgcggggtgggtcgaacatgatccggccgagatctggtcaaatgttcgtgaggtc
gtcggtgcagccatcggaaaagctgatatcccgaaggactcaatcgcggctgttggtatc
acaaatcagcgtgagaccactgtcgtgtgggaacgcgcaacgggaaagccgatctacaac
gcgattgtctggcaggacactcgaactgaagagctgtgccgcgaaattgctggatcgcaa
ggtcccgacctctaccgtgaacgaaccggtctgcccctctcaacgtatttctcgggcccc
aagatcagatggattctcgacgaggtcgatggggcccgcgagcgcgccgagcggggcgag
ctgtgctttggaaccatggacacctgggtgttgtggaatgccacaggtggaccggatgga
ggcgttcacgtcacggatgtcaccaacgcctcgcggacgctcctgatggacctcacgact
ctcgagtgggatgaggcgatctgtgcggacatcggagttcctatcgcgatgctcccggag
atccgcagctcatctgaggtctacggcagtgcccggccgaaacgcggcctagacggggtt
ccgatcgcggggatcctcggcgaccagcaggccgcaaccttcggccaggcgtgtctctcg
cctggagaagcgaagaacacatacggcaccggcaacttccttctgctgaacacgggcacc
tcgcccgtacagagtgaaaacggcctgctgacaacggtgtgctaccgcctcggctccgct
gatcctgtgtatgcgctggaaggatcgatcgccgttaccgggtccctggtgcagtggctg
cgagacaaccttgggctcatctcgtccgcagcggaggtcgaatccctggcccggtccgtc
gacgacaacgggggtgtgtatttcgttccagccttctctggactgttcgctccacggtgg
cgaccagacgcccgaggggtcatcgccggtctcacacggttccacaacaagggacacatc
gcgcgcgcggctctagaggcgaccgcctatcaaacacgtgaagttctcgaagccgcccga
gccgactccggcgttgacctcaccacgttgaaggtcgacggcgggatggtgtcgaacgag
ctactgatgcaattccaggcagacatgctcgacgttcccgtgatcagaccggtggtgtcg
gagacgaccgcgttaggagctgcctacgcggcagggctcgccgttgggttctgggacgac
gtcgaggacattcgctccaactgggcgcaagacaaagcctggcaaccgtcgatggacgca
cgtaaacgtgcccggctctacgccgactggaacaaggcggtggagcggacctacggctgg
gtctag

DBGET integrated database retrieval system