KEGG   Amycolicicoccus subflavus: AS9A_3915Help
Entry
AS9A_3915         CDS       T01514                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
asd  Amycolicicoccus subflavus
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:asd00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3982745..3984025)
Genome map
AA seq 426 aa AA seqDB search
MIHHHDAVSVIRAKRDGHALSDAQIDWVIDAYTRGDVADEQMSALAMAILLRGMNRDEIS
RWTAAMIASGERMNFSGLGRPTVDKHSTGGIGDKITLPLAPLVAACGAVVPQLAGRGLGY
TGGTLDKMEAVPGWRAALSNDELLKQLDSVGAAICAAGAGLAPADKKLYALRDVTGTVES
IALIASSIMSKKIAEGTSALVLDVKCGSGAFMTGAEDARELARTMVDLGNDSGVHTVALL
TDMDTPLGLTAGNALEVRESVEVLAGGGPPDVVELTLELAREMLSAVGITGVDPADALAD
GRAMDVWRRMIAAQGGDPAAELPAATETEIVIAPESGVLSRLDALAVGIAAWRLGAGRQR
QGEPVQPGSGVQWHAKVGDRVTKGQTLFTLHTDTPERIPASLAALNGSWEIGDSFEPRPL
VMDRIG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgattcaccaccacgacgctgtatccgtcattcgcgcgaaacgcgatggccacgccctg
tctgatgctcaaatcgattgggtgatcgacgcatacacgcgtggtgacgtcgcggacgaa
caaatgtcagcactcgcgatggcgattctgctccgcggaatgaaccgggacgagatttca
cggtggacagcggccatgattgcctccggtgaacgcatgaatttcagcgggcttgggcgt
ccgacggtggacaagcactccaccggaggaatcggcgacaaaatcaccttgccgctcgca
ccgctcgtcgcggcgtgcggcgccgtcgtgccgcaactggccggccgcggtctcggatat
accgggggcacactcgacaaaatggaggcggtgcctggctggcgcgcggcactatcaaac
gacgaactgctcaaacaactcgactcggttggcgcggctatctgcgcggcgggggctggg
ctcgccccagctgacaagaagctctacgccctgcgtgacgtcacagggaccgtcgaatcg
atcgcactgatcgctagttcgatcatgtccaagaaaatcgccgaaggaacatccgcgctg
gtcctcgacgtaaaatgcggctcaggggccttcatgacgggcgcggaagacgcacgcgaa
ctcgctcgcaccatggtcgacttgggtaacgactccggcgtgcacaccgtcgcactactc
accgatatggatactccccttggcttgacagccggtaacgcactggaggtccgcgaatca
gtggaagttctcgcaggcggcggcccgccagatgtcgtcgagctgacgctcgaactggcg
cgggaaatgctgtcggcagttgggatcaccggggtagaccccgccgatgccctcgcagac
ggtcgcgcgatggacgtctggcgccgaatgatcgcggcgcaagggggagatcctgctgcc
gaattgcctgcggccacggagaccgagatcgtcatcgctccggaatccggtgtgctctcc
cggctcgatgccttggcagtagggatcgcggcgtggcggctcggcgcggggcggcagcgg
cagggtgagccggtgcagcccggctccggtgtgcaatggcacgcgaaggtgggggaccgc
gtgacaaaggggcaaacactcttcaccttgcacaccgacaccccggagcggatcccagct
tcgctcgccgccctgaacggcagctgggagattggcgactcgtttgagccgcggccgctg
gtgatggatcgcatcgggtga

DBGET integrated database retrieval system