KEGG   Amycolicicoccus subflavus: AS9A_3915Help
Entry
AS9A_3915         CDS       T01514                                 

Gene name
deoA
Definition
(GenBank) Thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
asd  Amycolicicoccus subflavus
Pathway
asd00240  Pyrimidine metabolism
asd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AS9A_3915 (deoA)
Enzymes [BR:asd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     AS9A_3915 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N Biotin_lipoyl Biotin_lipoyl_2 TMP_2
Motif
Other DBs
NCBI-ProteinID: AEF42351
UniProt: F6EHI7
Position
complement(3982745..3984025)
Genome map
AA seq 426 aa AA seqDB search
MIHHHDAVSVIRAKRDGHALSDAQIDWVIDAYTRGDVADEQMSALAMAILLRGMNRDEIS
RWTAAMIASGERMNFSGLGRPTVDKHSTGGIGDKITLPLAPLVAACGAVVPQLAGRGLGY
TGGTLDKMEAVPGWRAALSNDELLKQLDSVGAAICAAGAGLAPADKKLYALRDVTGTVES
IALIASSIMSKKIAEGTSALVLDVKCGSGAFMTGAEDARELARTMVDLGNDSGVHTVALL
TDMDTPLGLTAGNALEVRESVEVLAGGGPPDVVELTLELAREMLSAVGITGVDPADALAD
GRAMDVWRRMIAAQGGDPAAELPAATETEIVIAPESGVLSRLDALAVGIAAWRLGAGRQR
QGEPVQPGSGVQWHAKVGDRVTKGQTLFTLHTDTPERIPASLAALNGSWEIGDSFEPRPL
VMDRIG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgattcaccaccacgacgctgtatccgtcattcgcgcgaaacgcgatggccacgccctg
tctgatgctcaaatcgattgggtgatcgacgcatacacgcgtggtgacgtcgcggacgaa
caaatgtcagcactcgcgatggcgattctgctccgcggaatgaaccgggacgagatttca
cggtggacagcggccatgattgcctccggtgaacgcatgaatttcagcgggcttgggcgt
ccgacggtggacaagcactccaccggaggaatcggcgacaaaatcaccttgccgctcgca
ccgctcgtcgcggcgtgcggcgccgtcgtgccgcaactggccggccgcggtctcggatat
accgggggcacactcgacaaaatggaggcggtgcctggctggcgcgcggcactatcaaac
gacgaactgctcaaacaactcgactcggttggcgcggctatctgcgcggcgggggctggg
ctcgccccagctgacaagaagctctacgccctgcgtgacgtcacagggaccgtcgaatcg
atcgcactgatcgctagttcgatcatgtccaagaaaatcgccgaaggaacatccgcgctg
gtcctcgacgtaaaatgcggctcaggggccttcatgacgggcgcggaagacgcacgcgaa
ctcgctcgcaccatggtcgacttgggtaacgactccggcgtgcacaccgtcgcactactc
accgatatggatactccccttggcttgacagccggtaacgcactggaggtccgcgaatca
gtggaagttctcgcaggcggcggcccgccagatgtcgtcgagctgacgctcgaactggcg
cgggaaatgctgtcggcagttgggatcaccggggtagaccccgccgatgccctcgcagac
ggtcgcgcgatggacgtctggcgccgaatgatcgcggcgcaagggggagatcctgctgcc
gaattgcctgcggccacggagaccgagatcgtcatcgctccggaatccggtgtgctctcc
cggctcgatgccttggcagtagggatcgcggcgtggcggctcggcgcggggcggcagcgg
cagggtgagccggtgcagcccggctccggtgtgcaatggcacgcgaaggtgggggaccgc
gtgacaaaggggcaaacactcttcaccttgcacaccgacaccccggagcggatcccagct
tcgctcgccgccctgaacggcagctgggagattggcgactcgtttgagccgcggccgctg
gtgatggatcgcatcgggtga

DBGET integrated database retrieval system