KEGG   Hoyosella subflava: AS9A_3918Help
Entry
AS9A_3918         CDS       T01514                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
asd  Hoyosella subflava
Pathway
asd00020  Citrate cycle (TCA cycle)
asd00190  Oxidative phosphorylation
asd00650  Butanoate metabolism
asd01100  Metabolic pathways
asd01110  Biosynthesis of secondary metabolites
asd01120  Microbial metabolism in diverse environments
asd01130  Biosynthesis of antibiotics
asd01200  Carbon metabolism
Module
asd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
asd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
asd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AS9A_3918 (sdhD)
   00650 Butanoate metabolism
    AS9A_3918 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    AS9A_3918 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS DUF5345
Motif
Other DBs
NCBI-ProteinID: AEF42354
UniProt: F6EHJ0
Position
3985197..3985538
Genome map
AA seq 113 aa AA seqDB search
MWSWLFMRISGLLLMFLVIGHISIMLLLDDGVHRINFAFVAGRWASPFWQIWDLSMLWLA
QLHGGNGLRTVINDYARKDSTRFWLTTLLVISIVLITGLGSYVIFTFDPNITG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgtggtcatggctcttcatgcgcatctccggcctgctgctcatgttcctcgtcatcggg
cacatttcgatcatgctgcttctcgacgacggcgtgcaccgcatcaatttcgcgttcgtt
gcaggccgctgggcaagcccgttctggcagatctgggatctgtcgatgctgtggcttgct
caacttcacggcggcaacggccttcgcaccgtcatcaatgactatgcacgcaaggattcg
acgcggttctggctgactacactcctcgtgatctcgatcgtcctgatcacgggcctgggc
agctatgtcatcttcacgttcgatcccaacatcaccggctga

DBGET integrated database retrieval system