KEGG   Amycolicicoccus subflavus: AS9A_3966Help
Entry
AS9A_3966         CDS       T01514                                 

Definition
putative fructokinase
Orthology
K03338  
5-dehydro-2-deoxygluconokinase [EC:2.7.1.92]
Organism
asd  Amycolicicoccus subflavus
Pathway
Inositol phosphate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:asd00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4030888..4031907
Genome map
AA seq 339 aa AA seqDB search
MQVTHTPSESSPAASNTSGAGGQVYDVLAIGRSGVDIYPLQIGTGLENVTSFGKFLGGSA
ANVTVAAARLGRRAALISGAGDDPFGRYVKQELQRLGVESRHVITSSEYATPVTFCEIFP
PDDFPLYFYRKPSAPDLQVTPADIDTAAVENAKLYWSTVTGLSEEPSRSAHFAAWQARAR
RKFTVLDLDYRPMFWDSAAAATEQVQKALPHITVAVGNREECEVAVGETDPHKAADALLD
FGVEIAIVKQGPKGVLGKTRDGSVVVPPIPVDVVNGLGAGDAFGGSLCHGLLAGWPLEKI
LRHANAAGAIVASRLECSTAMPTESEITALLPDEESLHV
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggtcacacataccccgtctgaatccagccccgccgcttcgaatacctcgggggct
ggcggccaggtttacgacgttctcgctatcggtcgtagcggggtcgatatctatccactg
cagatcggtaccggcctcgagaatgtcacctcgttcggaaaattcctcgggggcagcgct
gcgaacgtcaccgtagcggcggcgcgcctcggccgacgggccgccctgatttccggcgcg
ggtgacgatccgttcggccgctacgtcaaacaagaacttcagcggctcggtgtcgagagc
aggcacgtcatcaccagcagtgagtacgccacgcctgtcacgttctgcgagatcttcccg
cccgacgactttccgttgtacttctaccgcaagccctcggcgccggacctgcaggtcaca
cctgcagacatcgacaccgccgcggttgagaacgcaaaactctattggtctacggtcaca
ggattgtccgaagaacctagccgcagtgcacatttcgcggcctggcaggccagggcacga
cggaagttcacggtcttagatctcgactacaggccgatgttctgggattctgcagccgca
gcaactgagcaggtgcagaaggcacttccccacattactgtcgcggtcggaaaccgcgag
gagtgtgaagtcgccgtcggtgagactgacccgcacaaggccgcggatgcgttgctcgac
ttcggcgtcgagatcgcgatcgtcaagcagggcccgaagggggtcctgggcaaaacccgc
gacggctccgtcgtggtgccgcccatccccgtggatgtcgtgaacggactgggcgccgga
gatgccttcggcggctcactttgccatggtctgctcgctggatggccgctcgaaaagatc
cttcgccatgcgaacgccgccggagcgatcgtcgcctcccgtctcgaatgttccaccgca
atgcccaccgaaagcgaaatcaccgccctcctacccgacgaggagtccctccatgtctga

DBGET integrated database retrieval system