KEGG   Hoyosella subflava: AS9A_4029Help
Entry
AS9A_4029         CDS       T01514                                 

Definition
(GenBank) Cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
asd  Hoyosella subflava
Pathway
asd00984  Steroid degradation
asd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    AS9A_4029
Enzymes [BR:asd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     AS9A_4029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO GMC_oxred_C FAD_binding_2 GMC_oxred_N Pyr_redox_2 NAD_binding_8 FAD_binding_3 GIDA Pyr_redox HI0933_like Thi4 FAD_oxidored Fer4_9 Lycopene_cycl Fer4
Motif
Other DBs
NCBI-ProteinID: AEF42463
UniProt: F6EIH1
Position
complement(4094273..4095991)
Genome map
AA seq 572 aa AA seqDB search
MASRNSLDFDVVIVGSGFGGSVTALRLAEKGYKVAVLEAGRRFEDDQFPKTSWDVRRFLW
APKLGCYGIQRMHLLRDVMILGGAGVGGGSLNYANTLYVPGDPFFNDRQWAGITNWREEL
APHYEQAQRMLGVVRFPHMTPADYVMKEVADDMGVGGTFVHTPVGVYLGEPGQKVPDPYF
GGVGPERTGCTECGSCMTGCRVGAKNTLVKNYLALAENAGTQVFPLTTVTGLTQQDDGGW
SVETQRTGAWVRKHPKAFTAGQVVLAAGTWGTQNLLFKLRDEGRLPDLSPRLGVLTRTNS
ESIVGAAKYKVDPEMDLTQGVAITSSFHPTSDTHIEPVRYGKGSNAMGMLQTLMVDGGGR
VPRWLKFVFAVLRHPVQFARVLTVRNWSERTIIALVMQHLDNSITTYTKRGVLGRKLTSK
KGHGEPNPTWIPVGNEACRRIAKKIGGVAGGTWSEVFNIPLTAHFLGGAAIGESPDHGVI
DPYHRVYGYPTLHVADGAAVSANLGVNPSLTISAQAERAASLWPNKGEADQRPPQGQKYE
RIDPVPPRHPAVPVHAPAALGWPTLPRGEGVA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
gtggccagcagaaattcactcgacttcgacgtggtgatcgtcggctccggcttcggtggc
agcgtcaccgcgctgcggcttgccgaaaagggatacaaggtggctgtcctcgaagcgggc
cgccgcttcgaagacgaccagtttccgaagaccagctgggacgtccgcagatttctgtgg
gcgccaaagctgggctgctacggcatccagcgtatgcacctcctgcgtgacgtcatgatt
ctcggtggcgcgggcgttggtggtggttccctcaattacgcgaacacgctttatgtcccc
ggcgacccgttcttcaacgatcggcagtgggccggcatcaccaactggcgtgaggaactt
gcaccgcactacgaacaggcgcagcgcatgctgggagttgtgcgcttcccgcatatgacc
ccagcggattacgtgatgaaggaagtcgctgacgatatgggtgttggtggcacgttcgtg
cacacgcccgtgggtgtctacctcggcgaaccaggccagaaggtccctgacccctatttc
gggggcgtcggtcccgaacggaccggatgcacagaatgtggttcgtgcatgaccgggtgc
cgcgttggcgccaagaacacactggtcaaaaactatctcgcgctcgcagagaacgctggg
acgcaagttttcccgctgacaaccgtcaccggtctaactcagcaggacgatggcggatgg
agtgtggagacgcagcgcacgggcgcttgggtgcgcaagcatccgaaagccttcacagcc
gggcaggtcgtcctcgcggcaggaacctgggggacgcagaacctgctcttcaagcttcgc
gatgagggccggctgccggatctgtcacccagactcggagtgctgacgcgcaccaactca
gaatcgattgtcggcgcggctaaatacaaggtcgaccccgagatggacctgacacagggc
gtcgcgatcacttcgtcgttccaccccacatcggacactcatatcgagccggtgcggtac
ggcaagggatcgaacgctatgggcatgctgcagacgctgatggtcgacggtggcggtcgc
gttccccgctggctgaagttcgttttcgcggtgctgcggcatccagttcagttcgcgcgg
gtgctgacggtgcgcaactggagtgaacgcaccatcatcgccctagtcatgcagcatctt
gacaattcgattaccacttatacgaaacgtggagtgctgggccgaaagcttacgagcaag
aaaggccacggtgaacccaacccgacctggattcccgtaggtaatgaagcgtgtcgccgc
atcgcgaagaagatcggcggcgtcgctggtggcacgtggtccgaagtattcaacatcccg
ctgaccgcgcatttccttggcggcgccgcaattggagagagcccggaccacggcgtgatc
gatccctatcaccgggtgtatgggtatccgacattgcacgtggctgacggcgcggcggtg
tcagcgaacttgggcgtcaacccctcgctcaccatctcggcgcaggccgaacgtgcggcg
tcgttgtggccgaacaaaggtgaagccgaccagcgtccgccgcagggacagaagtatgag
cggattgatccagtgccgccgcgtcatcccgccgtccccgtccacgcgcccgccgcgctc
gggtggccgaccctcccgcggggggagggcgtcgcttaa

DBGET integrated database retrieval system