KEGG   Amycolicicoccus subflavus: AS9A_4198Help
Entry
AS9A_4198         CDS       T01514                                 

Definition
Uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
asd  Amycolicicoccus subflavus
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AS9A_4198
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    AS9A_4198
Enzymes [BR:asd01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     AS9A_4198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4325252..4326160)
Genome map
AA seq 302 aa AA seqDB search
MNISLGENQYGKAENRVVRIYRDTPRHEIRDLTVSTALRGDFTVAHTEGDQSPVLPTDTQ
KQTVYAFAKTHGGGTIEEYGIALARHFVDDVAPVNEARIEIDEHAWDRAIVDGAEHEHAW
TRRGPDVRTAAVTVSGSGAAQRIWVVGGIRDLVLLKSTGSEFRDFLRDEFTVLEPTTDRV
MATSLVAQWRFADINCDWDEIFASVRRTIVETFATHHSLALQQTLYTIGKNVLEAHRELV
EMRLSAPNKHHFLYDLERFGIENRNEVFHADDRPYGLIQATVLRDDAADAGPAWMQQLGW
LT
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgaatatctctctcggtgagaaccagtacggcaaagctgaaaatcgcgtggtgcgtatc
taccgcgatactccccggcatgagattcgggatctcaccgtctcaacggcactgcgcggg
gatttcaccgtcgcacataccgagggggaccagtcgcccgttcttccgaccgatacgcag
aagcagaccgtgtatgccttcgcgaagactcacggtggcggcacgatcgaggagtacggc
attgcgctcgcgcggcacttcgtggacgacgttgcgcccgtcaacgaggcgcgcatcgag
atcgacgagcacgcgtgggaccgtgcgatcgtcgatggcgcagagcacgaacacgcctgg
acacggcgtgggccagacgtacggacagctgcggtgaccgtgtcagggtcaggtgcagca
caacgaatctgggttgttggtggtatccgggatctcgtacttctcaagtcgacgggctcc
gagtttcgtgactttctccgcgacgagttcactgtgctggaacccacgacggaccgggtc
atggcgacgtcgctcgtcgcgcaatggcgcttcgcggacatcaactgcgattgggacgag
atttttgcgtccgtgcgcaggacgatcgtggagacgttcgccacgcatcattccctcgcc
ctccagcaaacgctctacacgatcggcaaaaacgtgctcgaggctcatcgcgaactcgtc
gaaatgcggctctcagcgccgaacaagcatcactttctttacgatttggagcgcttcggg
atcgagaaccgtaacgaagtattccacgcggatgaccggccgtatgggctgattcaggcg
acggtactccgggatgacgcggcagatgcgggccctgcatggatgcagcaactgggctgg
ctcacctga

DBGET integrated database retrieval system