KEGG   Amycolicicoccus subflavus: AS9A_4206Help
Entry
AS9A_4206         CDS       T01514                                 

Definition
short-chain dehydrogenase/reductase SDR
Organism
asd  Amycolicicoccus subflavus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4332195..4333097)
Genome map
AA seq 300 aa AA seqDB search
MEKSAVGKSVVITGANGGIGLATAVELAGRGFDVIGTVRSERGAETVADAAENAGVSVRT
VLCDVTDEEQTQAAFEEIAATTDGGPWALVNNAGIAQAGAIEDVSEELARRQVDVNLLAP
ARLMRLALPAMRARGEGRIVNVSSMSGRVALPFLGWYAASKYGLEAISDAARREVAGFGV
KVILIEPGSYGTGVWNTAFSALPEREKSAYQEAYAMVDQIEAGVADMPPPTPVAQTIRRA
LSSARPRSRYLVGTDAIGAVLLNSLAPTAVSDYAMRLGTGLTKAPKPFDKIVDRVVQQFV
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggagaagagtgcagtggggaagagtgtcgtcatcaccggagcgaacggcggtatcggt
ctcgcgacagcagtcgaactcgcaggacgcgggtttgatgtcatcgggacggtccggtct
gagcgcggcgccgagactgtcgcggatgctgccgaaaacgcgggtgtaagcgttcggacc
gttctctgcgacgtcacagatgaggagcagacgcaggcagcgttcgaggaaatcgcggcg
actaccgatggtggaccgtgggcacttgtcaacaacgcgggcatcgcccaggcgggggcc
attgaggatgtgagcgaggaactcgcgcggcggcaggtggacgttaacctcctggccccc
gcgcggcttatgcggcttgcgcttcccgctatgcgtgcgcgcggcgaggggcgaattgtc
aacgtttcgtctatgtctggccgggtcgcgttgccgtttctcggatggtacgcagcgtct
aaatatgggctcgaagcaatatctgacgctgcgcggcgcgaggtagcaggctttggtgtc
aaggtgatccttatcgagccaggcagctacgggaccggcgtctggaatacggctttctcg
gcgttgcctgagcgcgagaagtcggcataccaggaggcgtacgccatggtcgatcagatc
gaagctggcgtggcggacatgcccccgccgacgcctgtcgcgcagaccattcgccgtgcc
cttagcagcgcccgtccgcgtagtcgctaccttgttggcacggatgcgatcggggcggtg
ctgctgaactctctggcgccgacggcggtgtcggattatgcgatgcggctggggactggg
ctgacgaaagcaccgaaaccattcgacaagattgttgatcgtgtggttcagcagttcgtt
tag

DBGET integrated database retrieval system