KEGG   Amycolicicoccus subflavus: AS9A_4230Help
Entry
AS9A_4230         CDS       T01514                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
asd  Amycolicicoccus subflavus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:asd01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:asd00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:asd00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:asd00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4354399..4355496
Genome map
AA seq 365 aa AA seqDB search
MSDIQRVTMPKWGLSMESGKITEWLVKPGDTIADGDPICEIDTDKIAGELESTWDGTVRA
LVVDVNEDVPVGGTIAVVAPPEVSDDDISAVVAEAREQLASGAVEDESGPKIATVNVDGR
QISYASLGEGDETPIVFIHGYGGDKNSWLFVQEPVATNRVTYALDLPGHGASSKDVGDGS
LGTLARTVLGFLDEIGVSKAHLVAHSMGGAVAVTAAGHSPDRVASLSLISPAGFGPEINS
SYINGFATAETRRELKPHLQQLFADPGLVTRQLIDDLLKYKRLDGVDEALRQLSATLTSE
DLDVRTDLGRYHGKVAVVWGADDKIVPVSNASSLTNVKVLDGVGHMAHMESPQHVVTAIR
DATSV
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatccagcgcgtcaccatgccgaaatggggactgtcgatggagtccggaaag
atcaccgaatggctggtcaaacctggtgacacaatcgctgacggagacccgatctgtgag
atcgacaccgacaagatcgccggcgaactcgaatccacctgggacggtaccgtccgggca
ctggtcgtggatgtcaacgaggacgtcccggttggcggcaccatcgctgtcgtcgcacca
cctgaggtttccgacgacgacatcagcgccgtggtcgctgaagcgcgggaacaactcgcc
tccggcgccgtggaggacgagtccggcccgaagatcgcgactgtcaatgtcgacgggagg
cagatctcgtacgcctccctcggtgagggcgacgaaacaccgatcgtcttcatccacggg
tacggcggcgacaagaactcgtggctgtttgtccaggagcccgttgccacgaatcgggtc
acctacgctttggacctgcccgggcatggcgcttcatcgaaagacgtgggggacggttcc
ctcggaaccttggcgcgcaccgtgctcggtttcctcgacgaaatcggtgtcagcaaagcg
catctcgtcgcacattcgatgggtggcgcggtagctgtcacggcagcaggacacagccct
gacagggtcgcatcgctgagcctgatctcgcccgccgggttcggtccagagatcaactcg
tcgtacataaacggtttcgcgaccgccgaaacgcgacgcgaactgaagccgcatctgcag
caactcttcgccgatcccggccttgtcacccggcagctcatcgatgacctgctgaaatat
aagcgcctcgacggggtcgacgaggccctgcggcagctgtcagcaaccctgaccagcgaa
gatctcgacgtcagaaccgacctcgggcggtaccacggcaaagtcgccgtggtgtggggc
gcggacgacaagatcgtgcccgtatccaacgcgtcgagcctgaccaacgtgaaggtgctc
gatggtgtcggacatatggctcacatggagtcacctcagcacgtcgtcacggccattcgg
gacgctacaagcgtgtga

DBGET integrated database retrieval system