KEGG   Amycolicicoccus subflavus: AS9A_4230Help
Entry
AS9A_4230         CDS       T01514                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
asd  Amycolicicoccus subflavus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:asd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AS9A_4230
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AS9A_4230
   00020 Citrate cycle (TCA cycle)
    AS9A_4230
   00620 Pyruvate metabolism
    AS9A_4230
Enzymes [BR:asd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AS9A_4230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4354399..4355496
Genome map
AA seq 365 aa AA seqDB search
MSDIQRVTMPKWGLSMESGKITEWLVKPGDTIADGDPICEIDTDKIAGELESTWDGTVRA
LVVDVNEDVPVGGTIAVVAPPEVSDDDISAVVAEAREQLASGAVEDESGPKIATVNVDGR
QISYASLGEGDETPIVFIHGYGGDKNSWLFVQEPVATNRVTYALDLPGHGASSKDVGDGS
LGTLARTVLGFLDEIGVSKAHLVAHSMGGAVAVTAAGHSPDRVASLSLISPAGFGPEINS
SYINGFATAETRRELKPHLQQLFADPGLVTRQLIDDLLKYKRLDGVDEALRQLSATLTSE
DLDVRTDLGRYHGKVAVVWGADDKIVPVSNASSLTNVKVLDGVGHMAHMESPQHVVTAIR
DATSV
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatccagcgcgtcaccatgccgaaatggggactgtcgatggagtccggaaag
atcaccgaatggctggtcaaacctggtgacacaatcgctgacggagacccgatctgtgag
atcgacaccgacaagatcgccggcgaactcgaatccacctgggacggtaccgtccgggca
ctggtcgtggatgtcaacgaggacgtcccggttggcggcaccatcgctgtcgtcgcacca
cctgaggtttccgacgacgacatcagcgccgtggtcgctgaagcgcgggaacaactcgcc
tccggcgccgtggaggacgagtccggcccgaagatcgcgactgtcaatgtcgacgggagg
cagatctcgtacgcctccctcggtgagggcgacgaaacaccgatcgtcttcatccacggg
tacggcggcgacaagaactcgtggctgtttgtccaggagcccgttgccacgaatcgggtc
acctacgctttggacctgcccgggcatggcgcttcatcgaaagacgtgggggacggttcc
ctcggaaccttggcgcgcaccgtgctcggtttcctcgacgaaatcggtgtcagcaaagcg
catctcgtcgcacattcgatgggtggcgcggtagctgtcacggcagcaggacacagccct
gacagggtcgcatcgctgagcctgatctcgcccgccgggttcggtccagagatcaactcg
tcgtacataaacggtttcgcgaccgccgaaacgcgacgcgaactgaagccgcatctgcag
caactcttcgccgatcccggccttgtcacccggcagctcatcgatgacctgctgaaatat
aagcgcctcgacggggtcgacgaggccctgcggcagctgtcagcaaccctgaccagcgaa
gatctcgacgtcagaaccgacctcgggcggtaccacggcaaagtcgccgtggtgtggggc
gcggacgacaagatcgtgcccgtatccaacgcgtcgagcctgaccaacgtgaaggtgctc
gatggtgtcggacatatggctcacatggagtcacctcagcacgtcgtcacggccattcgg
gacgctacaagcgtgtga

DBGET integrated database retrieval system