KEGG   Amycolicicoccus subflavus: AS9A_4357Help
Entry
AS9A_4357         CDS       T01514                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
asd  Amycolicicoccus subflavus
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:asd00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4487399..4488916)
Genome map
AA seq 505 aa AA seqDB search
MANYVGAVDQGTTSTRFMVFDHDGNEIVRHQLEHEQIMPQPGWVEHNPVEIWERTSSVLQ
TALGRAGLCYSDLAALGITNQRETTVVWNRTTGRPYYNAIVWQDTRTDRIASALERAGKG
AVIRRKAGLPPATYFAGGKVQWILDNVDGVRADADRGDALFGTIDTWLLWNLTGGPNGGI
HVTDVTNASRTMLMNLETLDWDDELLSFFGIPRAMLPEIKPSSVSEGYGHTTESGPLGGR
VPLTAALGDQHAAMVGQVCFAPGEAKNTYGTGNFLLLNTGTELVHSDNGLLTTVCYQFGE
EAPRYALEGSIAVTGSAVQWLRDQLGIIQGAAQSESLAREVPDNGGVYFVPAFSGLFAPY
WRSDARGAIVGLSRFNSNAHIARATLESICYQSRDVADAMAKDSGVQLEVLKVDGGVTAN
SLCMQIQADVLGVPVSRPVVAETTALGAAYAAGLAVGFWKDTDELRQNWNEHNRWEPQWN
DEQRAVGYRRWQKAVERTFNWVDVA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaactacgtcggtgccgttgaccagggcaccaccagcacaaggttcatggtgttc
gatcacgatggcaatgaaatcgtgcgccaccagctcgagcacgagcagatcatgccgcag
ccgggctgggtagaacacaatccggttgagatttgggagcggacgtcgtccgtactccag
acggcgctggggagagcaggtctttgctacagcgacctagcggcgctcggtatcaccaat
cagcgggaaaccaccgtcgtctggaaccgcacaaccggccgaccctactacaacgcgatc
gtgtggcaagacacgcgcaccgaccgcatcgcctcggccctggaacgtgcgggcaaaggt
gccgtcatacggcgcaaagcgggcctgccgcccgccacatactttgcgggcggcaaagtc
caatggattctcgacaatgtcgacggggtgcgggcggacgcggaccgcggcgatgccctc
ttcggcacgattgacacctggctgctgtggaacctcacaggcggaccgaacggcgggatc
cacgtcaccgacgtgacgaacgcgagccgcaccatgctgatgaatctcgaaactctggac
tgggacgatgaactgttgtcgttctttgggattccccgtgcgatgctgcctgagataaag
ccgtcatctgtatccgagggttacgggcacaccaccgagagtgggccgctcggcggccgt
gtgccgctgactgccgcgctgggtgaccagcatgcggccatggtcgggcaggtgtgtttc
gcgcccggagaagcgaagaatacctacggcaccggcaatttcctgctcctcaacacaggc
accgaactcgtgcattcggacaacggtttgctgacgactgtgtgttaccagttcggtgag
gaggcgccgcgatacgcgctcgagggatctatcgcggtgacgggctcggcggtgcaatgg
ctgcgggaccaactcggcatcatccagggtgccgcgcagagcgaatcgctcgctcgtgag
gtgcctgacaatggcggcgtctatttcgtgcccgccttctccgggctgttcgctccctac
tggcgctccgatgcgcgcggcgcgatcgttgggctctcccggttcaacagcaacgcacac
atcgcccgtgccaccctcgaatcgatctgctatcagagccgcgatgtcgctgacgcgatg
gcgaaggactcgggggtgcaactcgaggtgctcaaggtcgacggcggggtcaccgcaaac
tcgctctgcatgcagatccaggcagatgtgctcggtgttccggtgagccgccccgtcgtc
gcggagacaaccgccctaggtgccgcctatgctgccggactcgcggtcgggttctggaaa
gacaccgatgagttgcgccagaactggaacgagcacaaccgctgggagccccagtggaac
gacgagcaacgagctgtcggctatcggcgctggcagaaagccgtcgagcggaccttcaac
tgggttgacgtggcgtga

DBGET integrated database retrieval system