KEGG   Actinoplanes sp. SE50/110: ACPL_1036Help
Entry
ACPL_1036         CDS       T02044                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    ACPL_1036
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    ACPL_1036
Enzymes [BR:ase01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     ACPL_1036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1067983..1070133
Genome map
AA seq 716 aa AA seqDB search
MLLKMAMAVVVAATPAVPCPRPAVTGTYSVGAAHWQPAHVAQTGQSAATVVIDPSRTEQR
YEGVGFSIDETAVANLWKLTPDRREQAIKLLVDPRTGAGLDRFRLTIGSPDLIEHLPFWS
YDDLPAGVTEDPELKYFSVQRDLDLHIVDTIKLIQKYNPRATFFASAWSAPAWMKTNNRF
LGEVALKPGSTTDYYQAGKLRDDRIDVFARYYVRYLQEYARLGIRVDAITLLNEPGMDVV
YPAMDISVEQQQRLAVAIKREFRRAGLRTSLYVHDFNFWDWRDPNSTATKNYYRILNDPQ
AARAADAIAFHPYWGDPQVMRDAYRQTGKPVQMTETSDLSPSTVLSYFRLDASSYILWAQ
TTDQDGGTLHWTGERNNNVDWDEVARTSRWPDRLVKVNTITKDYSVRDELYQLGQFARYL
TPAHVRVESSTTGHGISNVVYRDGRDYVAVLGNANATDTAVRVVAGDDSFVTTVPAGAYA
TYRWTGSRTDSRHNRAPLLPGVPPVTADQYATTRIALHATDPDHDRLHYYAVDLPAGASV
DPDTGVLTLDPAVPGEQQVTVAVTDGKAYAETTVHVTVVPHGAPVGAIVEAEAYTAQHGW
TEGGADFVESNGAASGGKDVGWTAPGNWLAYRFDVPAGPHRLELRVANGTGAVATGAISI
RDASGAVLAGVSVPDTGGWAAYQTVDVPVSLADGDQTLTVYCESGGFNLDYLRLAV
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgttgctcaagatggcgatggcggtggtggtcgctgccacgcccgctgtgccctgcccg
cggccggcggtcaccggcacctattcggtcggtgcggcccattggcagcccgctcacgtc
gcgcaaacgggacaatctgccgctacggtggtgatcgacccgagccggaccgaacagcga
tacgagggcgtcggcttctcgatcgacgagaccgccgtcgccaacctgtggaagctcact
cccgaccggcgggaacaggcgatcaagctgctggtcgacccgcgcaccggcgccggcctg
gaccgcttccgcctcaccatcggcagccccgacctgatcgagcacctgccgttctggtcc
tacgacgacctgcccgccggggtcaccgaggacccggagctgaagtacttctccgtccag
cgcgacctggatctgcacatcgtcgacacgatcaagctgatccagaagtacaacccgcgg
gccaccttcttcgcctccgcgtggagcgccccggcctggatgaagaccaacaacaggttc
ctcggcgaggtcgccctcaagccgggcagcaccaccgactactaccaggccggcaagctg
cgcgacgaccggatcgacgtgttcgcccggtactacgtcaggtatctgcaggagtacgcc
cggctgggcatcagggtcgacgcgatcacgctgctcaacgagccgggcatggacgtcgtc
taccccgccatggacatcagcgtcgagcagcagcagagactcgccgtcgcgatcaagcgc
gagttccgccgggccgggctgcgcaccagcctctacgtccacgacttcaacttctgggac
tggcgcgacccgaacagcacggccaccaagaactactaccggatcctgaacgacccgcag
gccgcgcgggctgccgacgcgatcgcgttccacccgtactggggtgacccgcaggtgatg
cgcgacgcgtaccggcagaccggcaaaccggtgcagatgaccgagaccagcgacctgtcc
ccgtcgaccgtgctgtcctacttccggctcgacgccagcagttacatcctctgggcgcag
accaccgaccaggacggcggcaccctgcactggaccggcgagcgcaacaacaacgtcgac
tgggacgaggtcgcccggaccagtaggtggcccgatcggctggtcaaggtcaacaccatc
accaaggattattcggtacgcgatgagctctaccaactgggccagttcgccaggtacctg
acgcccgcgcatgtgcgcgtcgagtccagcaccacgggccacgggatcagcaacgtcgtc
taccgggacgggcgggactacgtcgcggtgctgggcaacgccaacgccacggacaccgcc
gtgcgggtggtggccggcgacgactccttcgtcaccacggtgcccgccggggcgtacgcc
acctatcgatggaccggcagccggacggactcgcggcacaaccgcgccccgctgctgccc
ggcgtgcccccggtgaccgccgaccagtacgccaccacccggatcgccctgcatgcgacc
gatcctgatcatgacaggctgcactactacgcggtcgatctgccggccggtgcgagcgtc
gatccggacaccggggtcctgacgctggacccggcagtgcccggcgagcagcaggtcacc
gtcgcggtcaccgacggcaaggcgtacgccgagaccaccgtgcacgtcaccgtcgtcccg
cacggcgccccggtcggcgcgatcgtcgaggccgaggcgtacaccgcacagcacggctgg
accgagggcggcgccgacttcgtcgagagcaacggcgcggccagcggcggcaaggacgtc
ggctggaccgcgcccgggaactggctcgcctaccgcttcgacgtgccggccggcccgcac
cggctggagctgcgggtcgccaacggcaccggggcggtggccaccggcgcgatctcgatc
cgggacgcgtccggcgccgtgctggccggcgtctcggtgccggacaccggcggctgggcg
gcataccaaacggtggacgtgccggtctcgctggctgatggtgatcagacgcttacggtt
tactgtgaaagcggtgggttcaacctggactacctacggctggccgtgtag

DBGET integrated database retrieval system