KEGG   Actinoplanes sp. SE50/110: ACPL_1047Help
Entry
ACPL_1047         CDS       T02044                                 

Definition
gamma-glutamyl ligase (EC:6.3.2.-)
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:ase00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1080382..1081395)
Genome map
AA seq 337 aa AA seqDB search
MRLEVLPVEGIGDVTAGDDLAELITRAAPWLADGDVLVVTSKIVSKAEGRLVEVPADEPE
RDEARARVLVAETARVVARRGPTTIVQTHHGFVMAAAGIDASNVDKTHLVLLPADPDASA
RRLRADLAARGLDVAVVISDTMGRAWRNGLTDVALGAAGIEALLDHRGEIDPYGNELNLT
QMAVVDELSAAAELVKGKCDQVPVAVVRGYPIRPDTTGAGASVLIRDGESDMFRLGTAEA
RAEGLRAAALIADGAGPEPGPEPLARVLELVGAVVTPGIGIVGGTRSLRLTPAGPAPADL
LRLGADAHRIRAAFAAEGLTTRAEFDDDGVTINFGES
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaggctggaggtgctgccggtcgaggggatcggcgacgtcaccgccggcgacgacctg
gccgagctgatcacccgggcggcaccctggctggccgacggcgacgtgctggtggtgacc
agcaagatcgtgtcgaaggcggagggccggctggtcgaggtgccggccgacgagccggag
cgggacgaggcgcgggcccgggtgctggtggcggagaccgcccgggtggtggcccgtcgc
gggccgaccaccatcgtgcagacgcatcacgggttcgtgatggccgcggccggcatcgac
gcgtcgaacgtggacaagacgcacctggtgctgctgccggccgacccggacgcgtcggcc
cgccggttgcgcgccgatctcgccgcgcgggggctggacgtggcggtggtcatctcggac
acgatgggccgggcgtggcgcaacgggctcaccgacgtggcgctgggtgccgccgggatc
gaggcgcttctcgaccatcggggcgagatcgacccgtacggcaatgagttgaacttgacg
cagatggccgtcgtcgacgagctgtcggccgcggcggagctggtcaagggcaagtgtgac
caggtgccggtggcggtggtgcgcggctatccgatccggccggacacgaccggcgccgga
gcctcggtgctgatccgcgacggcgagagcgacatgttccggctgggcaccgcggaggcc
cgggcggaggggctgcgggcggccgcgctgatcgccgacggcgccggcccggagcccggc
ccggagccgctcgcgcgggtactggagctggtcggcgccgtggtgacgcccggcatcggg
atcgtcggtgggacgcggtcgctgcgactcaccccggccggtccggcgccggccgatctg
ctgcgcctcggcgccgacgcccaccggatccgcgcggccttcgccgccgagggcctgacc
acccgcgccgagttcgacgacgacggtgtgacgatcaacttcggagaatcatga

DBGET integrated database retrieval system