KEGG   Actinoplanes sp. SE50/110: ACPL_1161Help
Entry
ACPL_1161         CDS       T02044                                 

Gene name
pncA
Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:ase00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1205261..1205842)
Genome map
AA seq 193 aa AA seqDB search
MTRALIIVDVQNDFCEGGSLPVAGGAAVAKGISLVLDRAGDRWDHVVATKDYHIDPGAHF
SASPDFVDSWPAHCVAGSSGADFHPELITDRIEAIFHKGAHQAAYSGFEGHTDQGETLAG
WLRARAVTDVEVVGIATDHCVRATALDAATEGFATTVVLELTAGVAAATTEAALADFRAA
AVSMTGAPIVDPM
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcgcgctgatcatcgtggacgtgcagaacgacttctgcgaaggcggctcgctg
ccggtcgccggcggcgccgccgtcgccaagggcatctcgctggtcctcgacagggccggc
gaccgctgggaccacgtcgtcgccaccaaggactaccacatcgacccgggcgcgcacttc
agcgccagcccggacttcgtcgactcgtggccggcccactgcgtcgccgggtcctcgggc
gccgacttccaccccgagctgatcaccgaccggatcgaggcgatcttccacaagggcgcg
caccaggcggcgtactccggcttcgaagggcacaccgaccagggcgaaaccctcgccgga
tggttgcgggcccgggcggtcaccgacgtcgaggtcgtcgggatcgcgacagatcattgc
gtacgcgccaccgcgctggatgccgccaccgaaggcttcgccaccaccgtcgtcctcgaa
ctgaccgcgggtgtggcggcggccacgaccgaggcggctctggccgacttccgcgccgcg
gcggtgtcgatgaccggagccccgatcgtcgacccgatgtga

DBGET integrated database retrieval system