KEGG   Actinoplanes sp. SE50/110: ACPL_1346Help
Entry
ACPL_1346         CDS       T02044                                 

Gene name
fdhA
Definition
glutathione-independent formaldehyde dehydrogenase (EC:1.2.1.46)
Organism
ase  Actinoplanes sp. SE50/110
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1394891..1396051
Genome map
AA seq 386 aa AA seqDB search
MKAVVYEGPRQVSVKEVPDARIERPTDVLVRVTSANICGSDLHMYEGRTDFEPGRWFGHE
NLGQVVEVGDGVDKVQVGEYVVLPFNISCGHCKNCERQLTNYCLTAQPEPKMAGAAYGFA
DMGPWAGGQAELLRVPWGDFNCLRLGADAEERQTDYVMLADIFPTGYHATEMAGVQPGDQ
TVIYGAGPVGLMAALSATIRGASKVMVVDRHPDRLRLAESIGAIAIDDSKVDPVQAVLDQ
TMGLGADNGCECVGYQAHEPDGREQANLTMNRLVASVRFTGRIGNVGVFVPQDPGAGDEL
AKQGRLAFDYGMFWFKGQHIGSGQAPVKKYNRQLRDLIAAGKAEPSFIVSHELPLDQAPE
AYEHFDKRDDGWTKVVLHPAMAGAGA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtggtgtacgagggaccgcgacaggtcagcgtcaaggaggtgccggacgcg
cggatcgaacggcccacggatgtgctggtgcgcgtcacatcggcgaacatctgcggttcg
gatctgcacatgtacgagggccggaccgacttcgaacccggccgctggttcgggcacgag
aacctgggccaggtcgtcgaggtcggcgacggggtcgacaaagtgcaggtgggcgagtac
gtggtcctgccgttcaacatctcctgcgggcattgcaagaattgcgagcggcagctgacg
aactactgcctgaccgctcagccggagccgaagatggccggcgccgcatacggtttcgcg
gacatggggccatgggcggggggacaggccgaactgctccgggtgccctggggcgacttc
aactgtctgcggctgggtgcggacgccgaggagcgtcaaaccgactacgtgatgctggcc
gacatcttcccgaccggctaccacgccaccgagatggccggcgtgcagcccggtgaccag
acggtcatctacggcgccggtccggtcggtctgatggccgccctgtcggcgaccatccgc
ggagcgagcaaggtgatggtcgtcgaccggcaccccgaccggctgcggctggcggagtcg
atcggcgcgatcgccatcgacgactcgaaggtcgacccggtgcaggccgtcctggaccag
acgatgggactcggggcggacaacggctgcgagtgcgtcggctatcaggcgcacgagccg
gacggccgggagcaggccaacctgacgatgaaccggctggtcgcctcggtgcgcttcacc
gggaggatcggcaacgtcggcgtcttcgtgccccaggacccgggcgccggcgacgagctt
gccaaacagggcagactcgccttcgactacggcatgttctggttcaagggccagcacatc
ggcagcgggcaggccccggtcaagaagtacaaccggcagctgcgcgacctgatcgccgcc
ggcaaggccgaaccgtccttcatcgtcagtcacgagctgcccctcgaccaggcgcccgag
gcctacgagcacttcgacaagcgcgacgacggctggacgaaggtcgtcctgcaccccgcg
atggccggggcaggtgcctga

DBGET integrated database retrieval system