KEGG   Actinoplanes sp. SE50/110: ACPL_1346Help
Entry
ACPL_1346         CDS       T02044                                 

Gene name
fdhA
Definition
glutathione-independent formaldehyde dehydrogenase (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACPL_1346 (fdhA)
  Energy metabolism
   00680 Methane metabolism
    ACPL_1346 (fdhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ACPL_1346 (fdhA)
Enzymes [BR:ase01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     ACPL_1346 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1394891..1396051
Genome map
AA seq 386 aa AA seqDB search
MKAVVYEGPRQVSVKEVPDARIERPTDVLVRVTSANICGSDLHMYEGRTDFEPGRWFGHE
NLGQVVEVGDGVDKVQVGEYVVLPFNISCGHCKNCERQLTNYCLTAQPEPKMAGAAYGFA
DMGPWAGGQAELLRVPWGDFNCLRLGADAEERQTDYVMLADIFPTGYHATEMAGVQPGDQ
TVIYGAGPVGLMAALSATIRGASKVMVVDRHPDRLRLAESIGAIAIDDSKVDPVQAVLDQ
TMGLGADNGCECVGYQAHEPDGREQANLTMNRLVASVRFTGRIGNVGVFVPQDPGAGDEL
AKQGRLAFDYGMFWFKGQHIGSGQAPVKKYNRQLRDLIAAGKAEPSFIVSHELPLDQAPE
AYEHFDKRDDGWTKVVLHPAMAGAGA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtggtgtacgagggaccgcgacaggtcagcgtcaaggaggtgccggacgcg
cggatcgaacggcccacggatgtgctggtgcgcgtcacatcggcgaacatctgcggttcg
gatctgcacatgtacgagggccggaccgacttcgaacccggccgctggttcgggcacgag
aacctgggccaggtcgtcgaggtcggcgacggggtcgacaaagtgcaggtgggcgagtac
gtggtcctgccgttcaacatctcctgcgggcattgcaagaattgcgagcggcagctgacg
aactactgcctgaccgctcagccggagccgaagatggccggcgccgcatacggtttcgcg
gacatggggccatgggcggggggacaggccgaactgctccgggtgccctggggcgacttc
aactgtctgcggctgggtgcggacgccgaggagcgtcaaaccgactacgtgatgctggcc
gacatcttcccgaccggctaccacgccaccgagatggccggcgtgcagcccggtgaccag
acggtcatctacggcgccggtccggtcggtctgatggccgccctgtcggcgaccatccgc
ggagcgagcaaggtgatggtcgtcgaccggcaccccgaccggctgcggctggcggagtcg
atcggcgcgatcgccatcgacgactcgaaggtcgacccggtgcaggccgtcctggaccag
acgatgggactcggggcggacaacggctgcgagtgcgtcggctatcaggcgcacgagccg
gacggccgggagcaggccaacctgacgatgaaccggctggtcgcctcggtgcgcttcacc
gggaggatcggcaacgtcggcgtcttcgtgccccaggacccgggcgccggcgacgagctt
gccaaacagggcagactcgccttcgactacggcatgttctggttcaagggccagcacatc
ggcagcgggcaggccccggtcaagaagtacaaccggcagctgcgcgacctgatcgccgcc
ggcaaggccgaaccgtccttcatcgtcagtcacgagctgcccctcgaccaggcgcccgag
gcctacgagcacttcgacaagcgcgacgacggctggacgaaggtcgtcctgcaccccgcg
atggccggggcaggtgcctga

DBGET integrated database retrieval system