KEGG   Actinoplanes sp. SE50/110: ACPL_1520Help
Entry
ACPL_1520         CDS       T02044                                 

Gene name
nagA
Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ACPL_1520 (nagA)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    ACPL_1520 (nagA)
Enzymes [BR:ase01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ACPL_1520 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1586367..1588109
Genome map
AA seq 580 aa AA seqDB search
MAVVRKLSCVAFVAPLLLLIGACGDDAKPPPAAPPTTDPVGSVLSVPLSESASAPPGDPA
VRAAATVARLSDEDLAGQVLMPYAYGGSANRVDAGAVAGNRKLAGVDTPAEMIAKYRLGG
LILVSFTQQDPTGRTNPTSNVENPQQVRALTDGLQVAARQLPAAAPLMIGTDQEYGVVTR
ITDGVTVLPSALAAGAAGQPALTEAAWHAAGEELAAMGVTVDFAPVADTLGPAGSAVIGS
RSFGTDPAANAAQVAAAVRGLQGAGVAAALKHFPGHGHTSGDSHEELPVIRQSLAAWQAQ
DLPPFQAGVQAGAGVVMSGHLDLQAVDKGVPATFSHKIMTDVLRGRLQFTGVAITDAMNM
APARKWAPGEAAVRALNAGNDMLLMPPDIGAARDGILAGLRSGTLPRQRLTEAVTRILTL
KFRTAATAPPALAAIGTPAHQQAVAALDAAAVTVLRGRCSGPLVTGPVTVTAPASRETAR
VNLVHALQDAGVVVQAAGGAEIRLVGYGDQPVDLSPDAALTVITDLPGLLAYAKSPTLLA
TYSSSRLSMVALAAVIAGKTTAPGRSPIAVAGLPRSACGR
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcgtgagaaagttgtcttgtgtcgcttttgtcgctccgctgctcctgctcatc
ggggcctgcggagacgacgccaagccaccgccggccgccccgcccaccaccgatccggtc
gggtcggtgctgagcgtcccgctctccgaatcggcgtccgcgccacccggcgatccggcg
gtccgggcggccgccacggtggcccggctcagcgacgaggacctggccgggcaggtgctg
atgccgtacgcgtacggcggatcggcgaaccgggtcgacgccggcgcggtggccggcaac
cggaaactggccggcgtcgacaccccggccgagatgatcgccaaataccggctcggcggc
ctgatcctggtctcgttcacccagcaggacccgaccggccgaaccaaccccacctcgaac
gtggagaacccgcagcaggtccgggcgctcaccgacggcctgcaggtggccgcccggcag
ctgcccgccgcggccccgctgatgatcggcaccgaccaggagtacggggtggtcacccgg
atcaccgatggcgtcacggtgctcccgtcggcgctcgcggcgggcgccgccgggcagccc
gcgctgaccgaggcggcctggcacgcggccggcgaggagctggccgcgatgggcgtcacg
gtggacttcgccccggtcgccgacaccctcggaccggccggcagcgcggtgatcggctcc
cgctccttcggcaccgacccggcggcgaacgccgcccaggtcgccgccgccgtccggggc
ctgcagggggccggcgtcgcggccgccctcaaacacttcccggggcacgggcacaccagc
ggggacagccacgaggagctgccggtgatccggcagagcctggccgcctggcaggcccag
gacctgccgccgttccaggccggggtgcaggccggcgccggtgtggtgatgtccggccac
ctcgacctgcaggcggtcgacaagggggtgccggccaccttctcccacaagatcatgacc
gatgtgctacgcggccggctccagttcaccggggtggcgatcaccgacgcgatgaacatg
gcgccggcccgcaagtgggcgcccggcgaggcggcggtgcgggccctcaacgccggcaac
gacatgctgctcatgccgccggacatcggcgccgcccgggacggcatcctggccggcctg
aggagcgggacgctcccgcggcagcggctgaccgaggcggtcacccggatcctcaccctc
aagttccgcaccgcggccaccgccccacccgccctcgccgcgatcggcacgccggcgcac
cagcaggcggtcgccgcgctggacgccgccgcggtcaccgtgctgcgcggccggtgctcc
gggccgctggtaaccgggccggtcacggtcaccgcgccggcctcgcgggagaccgcccgg
gtgaacctggtgcacgccctgcaggacgccggggtggtcgtgcaggcggccggcggggcc
gagatccggctggtggggtacggcgaccagccggtcgacctgtccccggacgccgcgctg
acggtgatcaccgacctgccggggctgctcgcctacgccaagtcaccgacgctgctggcg
acgtactcgtcgagccggctgtcgatggtggcgctggccgcggtgatcgccgggaagacg
acggcaccgggtagatcgccgatcgcggtcgccggcctgccccgcagcgcctgcgggaga
tag

DBGET integrated database retrieval system