KEGG   Actinoplanes sp. SE50/110: ACPL_1616Help
Entry
ACPL_1616         CDS       T02044                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ase01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ase00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ase00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1713021..1713950)
Genome map
AA seq 309 aa AA seqDB search
MTPLVRKLAAEKGVDLSSLSGTGVGGRIRKQDVLDAAAAAQAAAAPAPAAAAPAAAAPAA
PAAKAEPSPLRGRTEKLTRIRATIARRMVESLQVSAQLTTVVEVDVTKIATLRNKAKADF
QAKHGVKLTFLPFFALATVEALQQHPVVNSSIDVEAGTVTYHGAEHLGIAVDAPKGLVVP
VIKDAGDLNLAGLAKRIADLADRTRNNKIGPDEIGGGTFTLTNTGSRGALFDTPIINQPQ
VGILGLGAVVKRPVIVNDPNLGEIIAPRSMVYLALSYDHRIVDGADAARFLVTLKERLEA
GHFEPDLGL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccgctggtccgcaagctggccgcggagaagggcgtggacctgtcctcgctgtcg
gggaccggcgtcggaggccggatccgcaagcaggacgtcctcgacgccgctgccgccgcc
caggccgccgcggcgccggcgcccgccgccgctgccccggctgccgctgcccccgccgct
ccggccgccaaggcggagccgagcccgctgcgcggccgcaccgagaagctgacccgcatc
cgggccaccatcgcccggcgcatggtggagtcgctgcaggtctcggcgcagctcaccacg
gtcgtcgaggtggacgtcaccaagatcgccacgctgcggaacaaggcgaaggccgacttc
caggccaagcacggcgtcaagctgaccttcctgccgttcttcgccctggccacggtcgag
gcgctgcagcagcacccggtggtcaactcgtcgatcgacgtcgaggcgggcacggtcacc
taccacggtgccgagcacctgggcatcgcggtggacgcgccgaagggcctggtcgtcccg
gtgatcaaggacgccggcgacctgaacctggccggcctggccaagcggatcgccgacctg
gccgaccgcacccgcaacaacaagatcgggccggacgagatcggcggcggtaccttcacg
ctgaccaacaccggcagccggggcgcgctgttcgacaccccgatcatcaaccagccgcag
gtcggcatcctcggcctcggcgccgtggtgaagcggccggtgatcgtgaacgacccgaac
ctcggcgagatcatcgcgccgcggtcgatggtctacctggcgctcagctacgaccaccgg
atcgtggacggcgcggacgccgcccgcttcctggtcacgctcaaggagcgtctggaggcc
ggccacttcgagccggacctgggcctgtag

DBGET integrated database retrieval system