KEGG   Actinoplanes sp. SE50/110: ACPL_1616Help
Entry
ACPL_1616         CDS       T02044                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACPL_1616 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACPL_1616 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    ACPL_1616 (sucB)
Enzymes [BR:ase01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ACPL_1616 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1713021..1713950)
Genome map
AA seq 309 aa AA seqDB search
MTPLVRKLAAEKGVDLSSLSGTGVGGRIRKQDVLDAAAAAQAAAAPAPAAAAPAAAAPAA
PAAKAEPSPLRGRTEKLTRIRATIARRMVESLQVSAQLTTVVEVDVTKIATLRNKAKADF
QAKHGVKLTFLPFFALATVEALQQHPVVNSSIDVEAGTVTYHGAEHLGIAVDAPKGLVVP
VIKDAGDLNLAGLAKRIADLADRTRNNKIGPDEIGGGTFTLTNTGSRGALFDTPIINQPQ
VGILGLGAVVKRPVIVNDPNLGEIIAPRSMVYLALSYDHRIVDGADAARFLVTLKERLEA
GHFEPDLGL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccgctggtccgcaagctggccgcggagaagggcgtggacctgtcctcgctgtcg
gggaccggcgtcggaggccggatccgcaagcaggacgtcctcgacgccgctgccgccgcc
caggccgccgcggcgccggcgcccgccgccgctgccccggctgccgctgcccccgccgct
ccggccgccaaggcggagccgagcccgctgcgcggccgcaccgagaagctgacccgcatc
cgggccaccatcgcccggcgcatggtggagtcgctgcaggtctcggcgcagctcaccacg
gtcgtcgaggtggacgtcaccaagatcgccacgctgcggaacaaggcgaaggccgacttc
caggccaagcacggcgtcaagctgaccttcctgccgttcttcgccctggccacggtcgag
gcgctgcagcagcacccggtggtcaactcgtcgatcgacgtcgaggcgggcacggtcacc
taccacggtgccgagcacctgggcatcgcggtggacgcgccgaagggcctggtcgtcccg
gtgatcaaggacgccggcgacctgaacctggccggcctggccaagcggatcgccgacctg
gccgaccgcacccgcaacaacaagatcgggccggacgagatcggcggcggtaccttcacg
ctgaccaacaccggcagccggggcgcgctgttcgacaccccgatcatcaaccagccgcag
gtcggcatcctcggcctcggcgccgtggtgaagcggccggtgatcgtgaacgacccgaac
ctcggcgagatcatcgcgccgcggtcgatggtctacctggcgctcagctacgaccaccgg
atcgtggacggcgcggacgccgcccgcttcctggtcacgctcaaggagcgtctggaggcc
ggccacttcgagccggacctgggcctgtag

DBGET integrated database retrieval system