KEGG   Actinoplanes sp. SE50/110: ACPL_1674Help
Entry
ACPL_1674         CDS       T02044                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACPL_1674
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACPL_1674
   00052 Galactose metabolism
    ACPL_1674
   00500 Starch and sucrose metabolism
    ACPL_1674
   00520 Amino sugar and nucleotide sugar metabolism
    ACPL_1674
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ACPL_1674
   00524 Butirosin and neomycin biosynthesis
    ACPL_1674
Enzymes [BR:ase01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ACPL_1674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1775174..1776121
Genome map
AA seq 315 aa AA seqDB search
MTLTIGIDVGGTKVAGGVVDEHGNVLASNRRPTPADDPAGTRDTIVEVAAELAAQYPAAT
AIGIGAAAWIDAAGSTVLFAPNLAWRDEPLRDYVSKAVGLPTVLENDANVAAWAEFRFGV
AKHADDSMVMITVGTGIGGGIVLNGKLWHGANGIAGELGHLQSVPDGHPCGCGRLGCLEQ
YASGNALVRFARAGARQEPERAAKLLELAGGDALAITGRQITEAARAGDGVAMDAFAQIG
YWLGVALADLAQSLDPQILVIGGGVIDAGPLLMGPAERTYRDQLAQRDRFPVAEVRAAQM
GNVAGVVGAADLARR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctgaccatcggaatcgacgtcggcggcaccaaggtcgccggtggtgtggtcgac
gagcacggcaacgtgctcgcttcgaaccggcggccgacaccggccgacgacccggccggc
acccgggacacgatcgtcgaggtggccgccgagctggcggcgcagtacccggccgcgacc
gcgatcgggatcggcgccgcggcctggatcgacgcggccgggtcgacggtgctgttcgcg
ccgaacctggcctggcgggacgagccgctgcgcgactacgtgtcgaaggccgtgggcctg
ccgaccgtgctggagaacgacgcgaacgtcgcggcctgggccgagttccggttcggggtg
gccaagcacgccgacgactcgatggtgatgatcacggtgggcaccgggatcggtggcggc
atcgtgctgaacggcaagctgtggcacggcgccaacgggatcgccggtgagctcggtcac
ctccagtcggtgccggacgggcatccgtgcggctgcggccggctcggctgcctggagcag
tatgcgagcggcaacgccctggtccggttcgcccgcgccggcgcccggcaggagccggag
cgggcggcgaagctgctggagctggccggtggggacgcgctggcgatcaccgggcggcag
atcaccgaggcggcccgggccggtgacggtgtggcgatggacgcgttcgcgcagatcggg
tactggctcggggtggccctggccgacctggcgcagagcctggacccgcagatcctggtg
atcggcggtggggtgatcgacgccggcccgctgctgatgggcccggcggagcggacctac
cgcgatcagctcgcccagcgggaccggttcccggtggccgaggtgcgcgccgcccagatg
ggtaatgtggccggcgtcgtgggcgcggccgacctggcccggcgttag

DBGET integrated database retrieval system