KEGG   Actinoplanes sp. SE50/110: ACPL_1686Help
Entry
ACPL_1686         CDS       T02044                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ase01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ase01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ase00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ase00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ase00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ase00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ase00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1787238..1788266
Genome map
AA seq 342 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRKGVTAYGHEFVGFRDGWKGPLEGLTKPLGIAEVRGI
LPRGGTILGSSRTNPFKIEGGVERIKANLAEQGVDALVAIGGEDTLGVATKLHDLGVNVV
GVPKTIDNDLNATDFTFGFDTAVNIAMEAIDRLHTTAESHHRTLVVEVMGRHAGWIALHA
GLAGGANVILLPERKFDVEQVATYVTKRFQVEYAPIVVVAEGAQPLDGQMVLHNQELDSF
GHVRLGGIGQWLAEQLEEKTGKEARTVVLGHIQRGGTPTAFDRVLSTRFGLQAIDAVHEG
DFGKMMALRGTDIVRVPLIEGTGELKTVPLSRYEEAEVFFGN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcggcgtgctcaccggtggcggcgactgccccggtctcaacgcggtcatccgt
gccgtggtgcgcaagggcgtcaccgcttacggccacgagttcgtcggcttccgcgacggc
tggaagggtccgctggagggtctgacgaagccgctgggcatcgcggaggtccggggcatc
ctgccgcgcggcggcaccatcctgggctcctcgcgcaccaaccccttcaagatcgagggt
ggcgtcgagcggatcaaggccaacctggctgagcagggtgtcgacgcgctggtcgcgatc
ggcggcgaggacaccctcggcgtcgcgaccaagctgcacgacctgggcgtcaacgtggtc
ggcgtgccgaagacgatcgacaacgacctgaacgccaccgacttcaccttcggcttcgac
accgcggtcaacatcgcgatggaggccatcgaccggctgcacaccaccgccgagtcgcac
caccgcaccctggtcgtcgaggtcatgggccggcacgccggctggatcgcgctgcacgcc
ggtctcgccggtggcgccaacgtcatcctgctgccggagcgcaagttcgacgtcgagcag
gtcgcgacgtacgtgaccaagcgcttccaggtggagtacgcgccgatcgtggtcgtcgcc
gagggcgcccagccgctcgacggccagatggtgctgcacaaccaggagctggacagcttc
ggccacgtccgcctcggcggcatcggccagtggctggccgagcagctggaggagaagacc
ggcaaggaggcccgcacggtcgtcctcggtcacatccagcgcggcggcaccccgaccgcg
ttcgaccgggtgctctccacccgcttcggcctgcaggcgatcgacgccgtgcacgagggc
gacttcggcaagatgatggcgctgcgcggcaccgacatcgtccgggtcccgctgatcgag
ggcaccggcgagctgaagaccgtcccgctgtcgcggtacgaagaggccgaggtcttcttc
ggcaactga

DBGET integrated database retrieval system