KEGG   Actinoplanes sp. SE50/110: ACPL_1686Help
Entry
ACPL_1686         CDS       T02044                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACPL_1686
   01230 Biosynthesis of amino acids
    ACPL_1686
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACPL_1686
   00030 Pentose phosphate pathway
    ACPL_1686
   00051 Fructose and mannose metabolism
    ACPL_1686
   00052 Galactose metabolism
    ACPL_1686
  Energy metabolism
   00680 Methane metabolism
    ACPL_1686
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ACPL_1686
Enzymes [BR:ase01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ACPL_1686
Protein phosphatases and associated proteins [BR:ase01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ACPL_1686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1787238..1788266
Genome map
AA seq 342 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRKGVTAYGHEFVGFRDGWKGPLEGLTKPLGIAEVRGI
LPRGGTILGSSRTNPFKIEGGVERIKANLAEQGVDALVAIGGEDTLGVATKLHDLGVNVV
GVPKTIDNDLNATDFTFGFDTAVNIAMEAIDRLHTTAESHHRTLVVEVMGRHAGWIALHA
GLAGGANVILLPERKFDVEQVATYVTKRFQVEYAPIVVVAEGAQPLDGQMVLHNQELDSF
GHVRLGGIGQWLAEQLEEKTGKEARTVVLGHIQRGGTPTAFDRVLSTRFGLQAIDAVHEG
DFGKMMALRGTDIVRVPLIEGTGELKTVPLSRYEEAEVFFGN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcggcgtgctcaccggtggcggcgactgccccggtctcaacgcggtcatccgt
gccgtggtgcgcaagggcgtcaccgcttacggccacgagttcgtcggcttccgcgacggc
tggaagggtccgctggagggtctgacgaagccgctgggcatcgcggaggtccggggcatc
ctgccgcgcggcggcaccatcctgggctcctcgcgcaccaaccccttcaagatcgagggt
ggcgtcgagcggatcaaggccaacctggctgagcagggtgtcgacgcgctggtcgcgatc
ggcggcgaggacaccctcggcgtcgcgaccaagctgcacgacctgggcgtcaacgtggtc
ggcgtgccgaagacgatcgacaacgacctgaacgccaccgacttcaccttcggcttcgac
accgcggtcaacatcgcgatggaggccatcgaccggctgcacaccaccgccgagtcgcac
caccgcaccctggtcgtcgaggtcatgggccggcacgccggctggatcgcgctgcacgcc
ggtctcgccggtggcgccaacgtcatcctgctgccggagcgcaagttcgacgtcgagcag
gtcgcgacgtacgtgaccaagcgcttccaggtggagtacgcgccgatcgtggtcgtcgcc
gagggcgcccagccgctcgacggccagatggtgctgcacaaccaggagctggacagcttc
ggccacgtccgcctcggcggcatcggccagtggctggccgagcagctggaggagaagacc
ggcaaggaggcccgcacggtcgtcctcggtcacatccagcgcggcggcaccccgaccgcg
ttcgaccgggtgctctccacccgcttcggcctgcaggcgatcgacgccgtgcacgagggc
gacttcggcaagatgatggcgctgcgcggcaccgacatcgtccgggtcccgctgatcgag
ggcaccggcgagctgaagaccgtcccgctgtcgcggtacgaagaggccgaggtcttcttc
ggcaactga

DBGET integrated database retrieval system