KEGG   Actinoplanes sp. SE50/110: ACPL_1686Help
Entry
ACPL_1686         CDS       T02044                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00010  Glycolysis / Gluconeogenesis
ase00030  Pentose phosphate pathway
ase00051  Fructose and mannose metabolism
ase00052  Galactose metabolism
ase00680  Methane metabolism
ase01100  Metabolic pathways
ase01110  Biosynthesis of secondary metabolites
ase01120  Microbial metabolism in diverse environments
ase01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACPL_1686
   00030 Pentose phosphate pathway
    ACPL_1686
   00051 Fructose and mannose metabolism
    ACPL_1686
   00052 Galactose metabolism
    ACPL_1686
  Energy metabolism
   00680 Methane metabolism
    ACPL_1686
Enzymes [BR:ase01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ACPL_1686
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     ACPL_1686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DUF128
Motif
Other DBs
NCBI-ProteinID: AEV82583
UniProt: G8S9N9
Position
1787238..1788266
Genome map
AA seq 342 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRKGVTAYGHEFVGFRDGWKGPLEGLTKPLGIAEVRGI
LPRGGTILGSSRTNPFKIEGGVERIKANLAEQGVDALVAIGGEDTLGVATKLHDLGVNVV
GVPKTIDNDLNATDFTFGFDTAVNIAMEAIDRLHTTAESHHRTLVVEVMGRHAGWIALHA
GLAGGANVILLPERKFDVEQVATYVTKRFQVEYAPIVVVAEGAQPLDGQMVLHNQELDSF
GHVRLGGIGQWLAEQLEEKTGKEARTVVLGHIQRGGTPTAFDRVLSTRFGLQAIDAVHEG
DFGKMMALRGTDIVRVPLIEGTGELKTVPLSRYEEAEVFFGN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcggcgtgctcaccggtggcggcgactgccccggtctcaacgcggtcatccgt
gccgtggtgcgcaagggcgtcaccgcttacggccacgagttcgtcggcttccgcgacggc
tggaagggtccgctggagggtctgacgaagccgctgggcatcgcggaggtccggggcatc
ctgccgcgcggcggcaccatcctgggctcctcgcgcaccaaccccttcaagatcgagggt
ggcgtcgagcggatcaaggccaacctggctgagcagggtgtcgacgcgctggtcgcgatc
ggcggcgaggacaccctcggcgtcgcgaccaagctgcacgacctgggcgtcaacgtggtc
ggcgtgccgaagacgatcgacaacgacctgaacgccaccgacttcaccttcggcttcgac
accgcggtcaacatcgcgatggaggccatcgaccggctgcacaccaccgccgagtcgcac
caccgcaccctggtcgtcgaggtcatgggccggcacgccggctggatcgcgctgcacgcc
ggtctcgccggtggcgccaacgtcatcctgctgccggagcgcaagttcgacgtcgagcag
gtcgcgacgtacgtgaccaagcgcttccaggtggagtacgcgccgatcgtggtcgtcgcc
gagggcgcccagccgctcgacggccagatggtgctgcacaaccaggagctggacagcttc
ggccacgtccgcctcggcggcatcggccagtggctggccgagcagctggaggagaagacc
ggcaaggaggcccgcacggtcgtcctcggtcacatccagcgcggcggcaccccgaccgcg
ttcgaccgggtgctctccacccgcttcggcctgcaggcgatcgacgccgtgcacgagggc
gacttcggcaagatgatggcgctgcgcggcaccgacatcgtccgggtcccgctgatcgag
ggcaccggcgagctgaagaccgtcccgctgtcgcggtacgaagaggccgaggtcttcttc
ggcaactga

DBGET integrated database retrieval system