KEGG   Actinoplanes sp. SE50/110: ACPL_1856Help
Entry
ACPL_1856         CDS       T02044                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ACPL_1856 (tpiA)
   01230 Biosynthesis of amino acids
    ACPL_1856 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACPL_1856 (tpiA)
   00051 Fructose and mannose metabolism
    ACPL_1856 (tpiA)
   00562 Inositol phosphate metabolism
    ACPL_1856 (tpiA)
Enzymes [BR:ase01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ACPL_1856 (tpiA)
Exosome [BR:ase04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ACPL_1856 (tpiA)
  Exosomal proteins of bladder cancer cells
   ACPL_1856 (tpiA)
  Exosomal proteins of melanoma cells
   ACPL_1856 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1981806..1982597
Genome map
AA seq 263 aa AA seqDB search
MGDVTRKPIIAGNWKMNLNHYEANLLVQKLAASLTGEQLDRVEAVVLPPFTDLRTVQTAI
EGDKLTIRYGAQDISKHASGAYTGEIAGSMLAKLGCTYVVIGHSERREYHEESDELINAK
IKAAFAAGLTPIFCVGEGLAVREESGHVAHCTAQVDAGLDGLKEDQIKQIVIAYEPVWAI
GTGKTATPDDAQEVCGAIRARLTEKFGADVAEAVRIQYGGSVKAANIAQIMAQPDVDGAL
VGGASLDAEEFASIVRFPEHVAR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacgtgacccgcaagccgatcatcgccggcaactggaagatgaacctcaaccac
tacgaggcgaatctgctggtccagaagctggcggcgagcctgaccggcgagcagctcgac
agggtggaggcggtcgtgctgccgccgttcaccgacctgcgcaccgtgcagaccgcgatc
gagggcgacaagctcacgatccggtacggcgcccaggacatctcgaagcacgcttccggc
gcgtacaccggggagatcgccggctcgatgctggcgaagctgggctgcacctacgtggtg
atcggccactccgagcgccgggagtaccacgaggagtccgacgagctgatcaacgcgaag
atcaaggcggccttcgcggccggcctgaccccgatcttctgcgtcggtgagggcctggcc
gtccgtgaggagtccggccacgtcgcgcactgcaccgcgcaggtcgacgccggcctggac
gggctcaaggaagaccagatcaagcagatcgtcatcgcgtacgagccggtctgggcgatc
ggcaccggcaagaccgcgacgccggacgacgcgcaggaggtgtgcggagcgatccgtgcc
cgcctgaccgagaagttcggcgccgacgtggccgaggcggtccgcatccagtacggcgga
tcggtcaaggccgcgaacatcgcccagatcatggcgcagccggacgtcgacggcgccctg
gtcggcggcgccagcctggacgccgaggagttcgcctccatcgtgcgattcccggagcac
gtcgcacgctga

DBGET integrated database retrieval system