KEGG   Actinoplanes sp. SE50/110: ACPL_193Help
Entry
ACPL_193          CDS       T02044                                 

Gene name
bkdH
Definition
(GenBank) pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00010  Glycolysis / Gluconeogenesis
ase00020  Citrate cycle (TCA cycle)
ase00620  Pyruvate metabolism
ase01100  Metabolic pathways
ase01110  Biosynthesis of secondary metabolites
ase01120  Microbial metabolism in diverse environments
ase01130  Biosynthesis of antibiotics
ase01200  Carbon metabolism
Module
ase_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ACPL_193 (bkdH)
   00020 Citrate cycle (TCA cycle)
    ACPL_193 (bkdH)
   00620 Pyruvate metabolism
    ACPL_193 (bkdH)
Enzymes [BR:ase01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ACPL_193 (bkdH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: AEV81092
UniProt: G8S4P5
Position
complement(82895..84265)
Genome map
AA seq 456 aa AA seqDB search
MSRIKEFNLPDLGEGLTEGEILAWLVKVGDTIELNQPIVEVETAKAAVEIPAKWAGVVTR
IFHEAGTTVEVGQPIISIDTDPGAGDLPATPEPAAAPAAATPHGGGRTPVLVGYGVRESS
AKRRPRISAPAASAPVIPAAPVAAPAPVAPVAPVAQAAAVAVPVRSGPVLAKPPVRKLAK
DLGVDLATLTGSGPLGSITRDDVHKALEMPAQPVSVLNGDREQRIPVKGVRKLTAENMVA
SAFTAPHVTEFLTVDVTRSMKALEKLKARRDFADLRVSPLLLVAKAVLLAVKRYPMVNSS
WSAAGPSTAEIVVKDYVNLGIAAATERGLIVPNIKDAGRLTLRELAESLNELVRTAKSGR
TSPADMAHGTLSITNVGVFGVDTGTPILPPGESAILAFGAIRPTPWVHKGKIKVRQVTTL
GLSFDHRIIDGELGSKFLRDIGEFLTDPEAALLAWT
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggatcaaggaattcaacctgcccgacctgggcgaggggctgaccgagggcgag
atcctcgcctggctcgtcaaggtcggcgacacgatcgagctgaaccagccgatcgtcgag
gtggagacggcgaaggcggccgtggagatcccggcgaagtgggccggggtggtcacccgg
atcttccacgaggcggggaccaccgtggaggtgggccagccgatcatctcgatcgacacc
gacccgggagccggggatcttcccgccactcccgagccggcggcggctccggccgcggcg
acgccgcacggcgggggccgcactccggtgctggtcgggtacggggtgcgggagagcagc
gcgaagcggcgaccccggatcagtgcgccggccgcatccgcaccggtcatcccggccgct
ccggtcgcggctccggctccggtcgccccggttgctccggtcgctcaggcggctgcggtc
gcggtgcctgttcgcagtgggccggtgctggccaagccgccggtgcgcaagctcgccaag
gacctgggggtggacctcgccaccctcaccgggtccgggccactggggtcgatcacgcgg
gacgacgtacacaaggcgctggaaatgccggcgcagccggtgagcgtgctgaacggcgac
cgcgagcagcgcatcccggtcaagggcgtacgcaagctgaccgcggagaacatggtggcc
tcggcgttcaccgcgccgcacgtcaccgagttcctcaccgtcgacgtgacccgcagcatg
aaggcgctggagaagctgaaggcccggcgcgacttcgccgacctgcgcgtctccccgctg
ctgctggtggccaaggcggtgctgctcgcggtcaagcggtatccgatggtcaactcgtcc
tggtcggcggccggcccctcaacggccgagatcgtggtcaaggactacgtgaacctgggt
atcgccgcggccaccgagcgcgggctgatcgtgccgaacatcaaggatgccggccgtctc
actctgcgggagcttgccgaatctctcaacgagctcgtccggacggccaagtcgggtagg
acgtcgccggccgacatggcgcacggcactctctcgatcaccaacgtgggcgtgttcggc
gtcgacaccgggaccccgatcctgccccccggcgaatcggcgatcctggccttcggcgcg
atccggccgacgccgtgggtgcacaagggcaagatcaaggtgcgccaggtcaccaccctc
gggctctccttcgaccaccggatcatcgacggcgagctgggctcgaagttcctccgggac
atcggcgagttcctcaccgacccggaagccgccctgctggcttggacttaa

DBGET integrated database retrieval system