KEGG   Actinoplanes sp. SE50/110: ACPL_2129Help
Entry
ACPL_2129         CDS       T02044                                 

Definition
Glycogen synthase (EC:2.4.1.21)
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACPL_2129
Enzymes [BR:ase01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     ACPL_2129
Glycosyltransferases [BR:ase01003]
 Polysaccharide
  Storage polysaccharide
   ACPL_2129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2271610..2273211)
Genome map
AA seq 533 aa AA seqDB search
MHRSDSPADVLYLALGPRRLTAAGAHTARLAAEGHSVTLAVTSENVNTPAGVTVRRVTSP
AQARALAEAAEVTYAGDAEALAAVYGLATRLEPSADPRRRPGPADLAVVTPWYPSPDDAF
AGAFVRAATGAVREHFARISVLHTQSWFYPPGRLRGQLLGVAAERQAVSSGNTVVFDDAE
GEVARVAVPTPAGGDYLAYADEQTAALRSALPTGRIEAPVVHAHTGIMGGVVAARLARPD
ARLVVTEHATYLSKVFAQPGARHRYARMLDRADALLCVSASLRDQLAGFFPAHTGKLHVV
PNAIDFGAFTVRPEPPKAPHRWLYLGRLMEHKGVLTLIDAFAAVAAEDPALTLTLVGSGP
LTDTVDARIAALGLTGRITRRPPVEPDRVTALLHEHDVLTHASVRETFGMTIVEAVATGT
PVLVALSEGPAETLAGLSGVAGETFAPTTDPAVIVAAYRRLRDGFGTLDMAAARAALDAR
YGRAAVAAQLLTAYRGGSSGGTPMPIPARPQRSGAVLPEAATRAARRVIRKFR
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccgatccgactcccctgccgacgttctctacctggccctcggcccccggcgcctc
accgccgccggggcgcacaccgcccgcctggccgccgaggggcactccgtcaccttggcc
gtgaccagcgagaacgtcaacacccccgcgggcgtcacggtgcgccgggtcacctcgccg
gcgcaggcccgggcgctggccgaggccgccgaggtcacctatgcgggcgacgccgaagcg
ctcgccgcagtttacggactcgccacccgcctcgagccgtcggccgacccgcggcgccgt
cccggccccgccgacctggccgtcgtcaccccctggtacccgtcgcccgacgacgcgttc
gccggcgccttcgtccgcgccgccaccggcgcggtccgcgagcacttcgcccggatctcg
gtgctgcacacgcagagctggttctacccgcccggccggctgcgcggccagctcctcggc
gtggccgccgaacgccaggcggtcagcagcggaaacaccgtcgtcttcgacgacgcggag
ggggaggtcgcgcgcgtcgcggtccccactccggccggcggggactatctggcgtacgcc
gacgagcagaccgccgcgctccgcagcgcgctgcccaccggccggatcgaggccccggtg
gtgcacgcccacaccgggatcatgggcggggtggtcgccgcccggctcgcccgtcccgac
gcccggctggtggtcaccgaacacgccacgtatctgtccaaggtcttcgcccagcccggc
gcgcggcaccgctacgcccgcatgctggaccgcgccgacgctctgctctgcgtcagcgcc
agcctccgtgaccagctcgccggcttcttcccggcgcacaccggcaaactgcacgtggtg
ccgaacgcgatcgatttcggcgcgttcaccgtccgcccggagccgccgaaggccccgcac
cgctggctgtacctgggccgcctgatggagcacaagggcgtcctcaccctgatcgacgcg
ttcgccgcggtcgccgccgaggacccggcgctcaccctcaccctggtcggttccggtccg
ctcaccgacacggtcgacgccaggatcgcggcgctcgggctgaccgggcggatcacccgg
cgcccgccggtcgagccggaccgggtgaccgccctgctgcacgagcacgacgtactcacc
cacgccagcgtccgggagaccttcggcatgacgatcgtcgaagcggtggcgaccgggacg
ccggtgctcgtcgcgctcagcgagggcccggccgagacgctggccgggctgtccggggtg
gcgggcgagacgttcgcgccgaccaccgacccggcggtgatcgtggcggcctaccgccgg
ctgcgcgacggcttcggcaccctcgacatggcggccgcccgggcggccctcgacgcccga
tacgggcgggcggcggtcgcggctcagctgctcaccgcgtaccgcggaggttcttccggc
gggacgccgatgccgatcccggcacgcccgcagcgatccggcgcggtgctgccggaggca
gcgacccgtgcggcccgccgcgtcatccgcaaattccgctga

DBGET integrated database retrieval system