KEGG   Actinoplanes sp. SE50/110: ACPL_2567Help
Entry
ACPL_2567         CDS       T02044                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ACPL_2567
Enzymes [BR:ase01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ACPL_2567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2777008..2778108
Genome map
AA seq 366 aa AA seqDB search
MTEGALAGFTVAVTAERRRGEMTALLERRGARVVSAPAITIVPLIDDDALRAATEACIGL
EPHLVVATTGFGFRGWLEAAEGWGLAETLREALRAAKIIARGPKPCGAIRAAGLSEDWAA
KTEASEEVLERLLHDGVAGRKIVVQEHGEPQTEFVNALRAAGAAVVEVPVYRWALPADTT
PVRRLAEQVAAGQIDAVTFTSAPAVKAFLQIAGETGVDVPAAFRDGTLAACVGPVTAAPL
VERDVPVVMPERFRLGALIKTVTDELPRRAVRLRVAGTTLEVRGHAVLIDGAVHALAPAA
MAILASLARRPGAVVSKEQLAAALPRGNDGHAVDVAVARLRAALGSGRHIETVIKRGYRL
RVDEAA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagggcgcactggccgggttcaccgtggcggtcaccgcggaacggcgccgcggt
gagatgaccgcgctgctggagcggcggggggctcgggtggtgagcgcgccggcgatcacc
attgtgccgctgatcgacgacgacgcgctgcgcgcggcgaccgaggcgtgcatcgggctg
gagccgcatctcgtggtggcgaccaccgggttcggcttccggggctggctggaggcggcc
gagggctggggactcgccgagacgctgcgcgaggcgctgcgagccgcgaagatcatcgcc
cgggggccgaaaccgtgcggggcgatccgggcggccgggctctccgaggactgggcggcc
aagaccgaggcgtcggaggaggtgctcgaacggctgctgcacgacggggtggccgggcgc
aagatcgtggtgcaggagcacggtgagccgcagaccgagttcgtgaacgcgctgcgcgcc
gccggggccgccgtggtcgaggtgccggtgtaccgctgggcgctgccggccgacaccacc
ccggtccgccggctggccgagcaggtggccgccgggcagatcgatgcggtcacgttcacc
agcgcgccggcggtcaaggcgttcctgcagatcgccggggagaccggcgtggacgtgccg
gccgccttccgggacggcacgctggccgcctgcgtgggtccggtgaccgcggcgccgctg
gtggagcgggacgtgccggtggtgatgccggaacggttccggctcggtgcgctgatcaag
acggtcaccgacgagctgccccggcgggcggtgcggctgcgggtcgccgggacgacgctc
gaggttcgcgggcacgcggtgctgatcgacggggcggtccacgcgctggccccggccgcc
atggcgatcctggcgtcgctggcccgccggccgggcgcggtggtctccaaggaacagctc
gcggcggcgctgccgcggggcaacgacgggcacgccgtggacgtggcggtggcccggctg
cgggccgccctcggctccggcaggcacatcgagaccgtgatcaaacgcggctaccgtctc
cgggtcgacgaagcagcctga

DBGET integrated database retrieval system