KEGG   Actinoplanes sp. SE50/110: ACPL_2610Help
Entry
ACPL_2610         CDS       T02044                                 

Gene name
gba
Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ase00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ase00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2824077..2825990)
Genome map
AA seq 637 aa AA seqDB search
MMRRGVAALVPAILLIPGPAVAAVGRPGGGEPRARVWVTTVDRSELLHERSPVGFRRGSS
ALTTITVNPERTFQRMDGFGAALTDAAASVLYRLSAADRADAVQQLFDPEKGIGVSFLRQ
PIGSSDFTAAAAHYTYDDVPAGQTDFGLRHFSVEHDRAQILPLLRAARRLNPRLTVLATP
WSPPAWMKTGGSLIGGRLRDDPRIYDAYARYLVRFVQAYAAAGVPVDYLTVQNEPQNRLP
GGYPGTDMPVRQEAAVIERLGPLLRQVSPRTRILGYDHNWQTHPGDVGSTPPGEDPETDY
PYRLLDSPAGKWLAGTAYHCYSGDPGAQTALHEAHPDKGIWFTECSGSHGAGDTDEQIFR
GTLTWHARTLAIGVPRNWAKSVVNWNIALDSGGGPHLGGCGTCTGLLTLLPDGTVRRDAE
FFTIGHLSKFVRPGAVRIASTSFGTTGWNGQIMDVAFRNPDGSTALVVHNENDEPRSFAV
AVGARTFEYTLPGGALATFVWPRSVGARPGEIPLTGATAVAVPPGEGAPLAVDGDASTRW
SSGAAQAPGQYLQVDLGADRVFRRVAVDSGDNLGDYARGWQLSVSRDGATWTTVAAGAGT
GQLTEVALRPTRARYLRITSTGGSGSWWSVADLRLYR
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggcgcggtgtggcggcacttgttccagcgatcctgctcattccgggcccggcg
gtggcggccgtggggcggcccggtggcggggaaccccgggcgcgggtgtgggtcaccacg
gtggaccgctcggagttgctgcacgagcggtcaccggtcggcttccgccgggggagcagc
gcactgaccacgatcacggtgaacccggagcggaccttccagcggatggacggcttcggg
gcggcgctcaccgatgccgcggcgagcgtgctctaccggctgagcgcggcggaccgtgcc
gacgccgtacaacaattgttcgatcctgaaaaggggatcggggtcagcttcctgcggcag
ccgatcggctcgtccgacttcaccgccgcggccgcgcattacacctatgacgacgtgccg
gccgggcaaaccgatttcgggttgcggcatttcagcgtggagcacgatcgggcgcagatc
ctgccgctgctgcgcgcggcgcgccggctgaatccgcggctgaccgtgctcgccacgccg
tggagcccgccggcctggatgaagaccggcggctcgctgatcggtgggcgactcagggac
gacccgcggatctacgacgcgtacgcgcggtatctggtgagattcgtccaggcctatgcc
gccgcgggtgtcccggtcgactacctgaccgtgcagaacgagccgcagaaccggctgccc
ggcggctatccgggcaccgacatgccggtgcgccaggaggcggcggtgatcgagcggctc
ggcccgctgctgcgtcaggtcagcccgcgcacccggatcctgggatacgaccacaactgg
cagacccacccgggtgatgtcgggtccaccccgcccggcgaggacccggagaccgactac
ccgtaccggctgctggactccccggccgggaagtggctggccggaacggcctaccactgc
tattccggcgatccgggtgcgcagaccgccctgcacgaggcgcacccggacaagggcatc
tggttcaccgagtgttccggttcgcacggcgccggcgacaccgacgagcagatcttccgc
ggcaccctcacctggcacgcccgcacgctggccatcggggtgccgcggaactgggcgaag
tcggtggtcaactggaacatcgcgctggacagcggcggcggcccgcacctgggtggctgc
ggcacctgcaccgggctgctgaccctgctgccggacgggacggtgcgccgggacgcggag
ttcttcaccatcgggcacctgtcgaagttcgtccggcccggcgcggtgcggatcgccagc
acctcgttcggcaccaccggctggaacggccagatcatggacgtcgcgttccgcaatccg
gacggctccaccgcgttggtggtgcacaacgagaacgacgagccgcgcagtttcgcggtc
gcggtcggcgcccgcaccttcgagtacacgctgcccggcggggcgctggccactttcgtc
tggccgcgctcggtaggcgcccgccccggcgagatcccgctgaccggggcgaccgcggtc
gccgtcccgccgggcgagggcgcgccgctggccgtcgacggcgacgcgtcgacccggtgg
tccagcggggcggcccaggcgcccgggcagtatctgcaggtcgatctcggcgccgaccgg
gtgttccgccgggtggccgtcgacagtggggacaacctcggcgattacgcccgcggctgg
cagctgtcggtcagccgggacggggccacctggaccacggtggccgccggcgccgggacc
ggtcagctgaccgaggtggcgctgcggccgacccgggcccgctacctgcgcatcacctcg
accggcggcagcggcagttggtggagcgtggccgacctgcgcctgtaccgctga

DBGET integrated database retrieval system