KEGG   Actinoplanes sp. SE50/110: ACPL_2726Help
Entry
ACPL_2726         CDS       T02044                                 

Gene name
cheR
Definition
chemotaxis protein methyltransferase CheR (EC:3.1.1.61)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ase02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ase02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2944469..2946319)
Genome map
AA seq 616 aa AA seqDB search
MDELDSEFEALLTYLKESRGFDFTGYKRSSLSRRVHRRMSTIPVTGYGDYLDYLQVHPDE
FTALFNTILINVTAFFRDAEAWDFLRSDVLLPMLAAKPEGSPIRIWSAGCASGQEACTLA
MLLGEILGPEQFHERVKIYATDVDEEQLNEARHASYSARDVESVPPGLLERYFEVIGNRY
VFRKDMRRSVIFGRNDLVQDAPISRVDLLTCRNTLMYFNAETQARILNRFHFALAEGGAL
FLGKAEMLLSHSSLFLPIDLKRRIFRKVPTRPMMTTGIARADQLAAPAPTPLVGLDQLRN
AALMAAPAAQIVVTVDGLVALTNHQAESLFGVSPRDVGRPFRDLDVSYRPVELRRYLEQV
QVERRALHVPDVEWTRGPGETRYLDIQVTPLVDGDAGLLGVSLIFHDVSAAKQLRVDLER
ANRELEAAYEELQSTNEELETTNEELQSTVEELETTNEELQSTNEELETMNEELQSTNDE
LQSINEQLHNSSADLDGANAFLDAILSGLRAGIAVVDRDLRVLVWNRQAEELWGLRSGEA
IDKHLLNLDIGLPVDQIRPLIRASLSGETTDNEIRLEAVNRRGRSITVRVACSPLLDVAS
VPTGSIIVMDAVAPSA
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggatgagctggatagcgagttcgaggcgctcctgacctatctgaaggagtcgcggggc
ttcgacttcaccggctacaagcggtccagcctgagccgccgggtgcaccggcggatgtcc
accatcccggtcaccgggtacggcgactacctggattacctgcaggtccacccggacgag
ttcaccgcgctgttcaacaccatcctgatcaacgtgaccgcgttcttccgcgacgccgag
gcctgggacttcctgcgctcggacgtgttgctcccgatgctcgccgccaagccggagggc
agcccgatccggatctggagcgccggctgcgcctccgggcaggaagcctgcacgctggcc
atgctgctgggcgagatcctcggcccggagcagttccatgagcgggtcaagatctacgcc
accgacgtggacgaggagcagctcaacgaggcgcggcacgccagctacagtgcgcgggac
gtggagagtgtcccgcccgggctgctggagcgctacttcgaggtgatcggcaaccggtac
gtgttccgcaaggacatgcgccgctcggtgatcttcggccgcaacgatctggtgcaggac
gccccgatctcccgggtcgacctgctgacctgccgcaacacgctgatgtacttcaacgcc
gagacgcaggcgcggatcctcaaccggttccatttcgcgctggccgagggcggcgccctg
ttcctgggcaaggccgagatgctgttgagccacagcagcctgttcctcccgatcgatctg
aagcggcggatcttccgcaaggtgccgacccggccgatgatgaccaccggcatcgcccgg
gccgatcagctcgccgccccggcgccgacgccgctggtcgggctcgaccagctgcgcaac
gccgcgctgatggccgcaccggcggcgcagatcgtggtgaccgtggacgggctggtcgcg
ctcaccaaccaccaggcggagtcgctgttcggggtgtcgccgcgcgacgtcggccggccg
tttcgcgacctggacgtctcctaccggccggtggagctgcgccgctatctggagcaggtc
caggtggaacggcgcgcgctgcacgtgccggacgtcgagtggacccgcggccccggcgag
acgcgctacctggacatccaggtcacccccctggtcgacggggacgccggcctgctgggc
gtctcgctgatcttccacgacgtgagcgccgccaagcagctgcgggtcgacctggaacgg
gccaaccgggagctggaggcggcgtacgaggagctccagtcgaccaacgaggagctggag
accaccaacgaggagctccagtcgaccgtggaggagctggagaccaccaacgaggagctc
cagtccaccaacgaggagctggagacgatgaacgaggagctccagtcgaccaacgacgag
ctccagagcatcaacgagcagctgcacaacagcagcgccgacctggacggggcgaacgcg
ttcctggacgccatcctgtccgggctgcgcgccggcatcgcggtggtcgaccgggatctg
cgggtcctggtctggaaccggcaggccgaggagctgtgggggctgcggtccggcgaggcg
atcgacaagcacctgctgaacctggacatcgggctcccggtcgaccagatccggccgctg
atccgggcctcgctcagcggggagaccaccgacaacgagatccggttggaggcggtcaac
cggcgcggccggtcgatcaccgtgcgggtcgcctgcagtccgctgctggacgtggcgagc
gtgccgaccggcagcatcatcgtgatggacgcggtcgccccctctgcctag

DBGET integrated database retrieval system