KEGG   Actinoplanes sp. SE50/110: ACPL_2730Help
Entry
ACPL_2730         CDS       T02044                                 

Gene name
cheB
Definition
two-component system, chemotaxis family, response regulator CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ase02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ase02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2948626..2949612)
Genome map
AA seq 328 aa AA seqDB search
MTRRDVVVIGGSAGAHKPLTQLLSRLPADLPAAVLVVLHLAPGARSTLAEMLGSACALPV
RTAADGEPIRTGQVYVGAADRHLVVDGDVLRLSDGPRQNRVRPAVDALFRAVARWCGPRA
IGVVLSGSLDDGAAGLAAIVAGGGLALVQDPAEARFPGMPRAALRVVPQAVTASALDLGD
LVAGSAGQPTGAGEGPQEALRWETDMIADGSSDARDRGEPVALGCPECHGGMYVVRTGRA
AHYVCHVGHSYSPQTLLAARDNGLEEALWTAVSVLQEKVMILRELIDQAEKAGEAEVARG
YRAEADRTSAAAALLQEQAAGSRRTAAR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtcgcgacgtggtcgtgatcggcgggtcggcgggcgcgcacaagcctctgacc
cagctgctgtcccggctacccgccgatctgccggcggccgtgctggtcgtcctgcatctg
gcgcccggcgcccgcagcacgctggccgagatgctgggctcggcctgcgcgctgccggtg
cgcaccgcggccgacggggagccgatcaggaccggtcaggtgtatgtcggtgccgccgac
cggcatctggtcgtcgacggcgacgtgctgcggctcagcgacggtccccggcagaaccgg
gtgcgccccgcggtggacgcgctgttccgggccgtcgcccgctggtgcggaccccgggcg
atcggcgtggtgctctccggcagcctggacgacggggccgccggcctggccgcgatcgtc
gccggcggcggcctcgccctggtccaggatccggccgaggcccggttccccggcatgccg
cgggcggcgctgcgggtggtgccgcaggcggtgacggcctcggcgctcgatctgggcgat
ctggtggccgggtcggccgggcagccgaccggtgcgggggaggggccgcaggaagcgttg
aggtgggagacggacatgatcgccgacggttcctccgacgcccgggaccggggcgagccg
gtcgcgctgggctgccccgagtgccacggcgggatgtacgtcgtgcggaccggccgggcg
gcgcactacgtctgtcacgtcggtcactcctattcaccgcagaccctgctggccgcccgg
gacaacgggctggaggaggcgctgtggaccgcggtcagcgtcctgcaggagaaggtgatg
atcctgcgggagctgatcgaccaggccgagaaggccggtgaggccgaggtggcgcgtggc
taccgggcggaggcggaccggacgagcgccgcggccgccctgctgcaggagcaggcggcc
gggtcgaggaggacggcggcgcgctga

DBGET integrated database retrieval system