KEGG   Actinoplanes sp. SE50/110: ACPL_3014Help
Entry
ACPL_3014         CDS       T02044                                 

Gene name
xlnA
Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ase  Actinoplanes sp. SE50/110
Brite
Enzymes [BR:ase01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     ACPL_3014 (xlnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3273300..3274766)
Genome map
AA seq 488 aa AA seqDB search
MANESPRRRSLPVRALLAGTVAAVGAFTALMVTPDANAAAGTLGAAAAQSGRYFGTAIAA
GRLGDATYTTIAGREFTMVTPENEMKPDATEPQRGQFTFSSGDQIYNWATQRGMKVRGHT
LAWHSQQPGWMQSLNGSGLRQAMIDHINGVMAHYKGKLAYWDVVNEAYNEDGSRRQSNLQ
GTGNDWIEVAFRTARAADPSVKLCYNDYNIENWSYAKTQGVYNMIRDFKSRGVPIDCVGL
QTHFTGGSSLPGNFPTTLSSFAALGVDVALTEVDVTNASTSQYAGLTQACVNVPRCVGIT
VWGVRDSDSWRSSESPLLFDGGGTKKAAYTSVLNALNAAGPVTSSPTPGGGSGSPSSSPS
TPPAGTGRIVGAQSGRCIDVPNASQNNGTRVQLYDCNGQTNQAWTLTSGKQLTVYGNRCL
DAAGSGNGAAVQIYSCNGQANQQWNVNANGTITGVQSGRCLDVWGTGNGQQVQIYDCSGQ
ANQRFTLS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaacgaatccccccgccggcgatccctgccggtccgggccctgctcgccggcacc
gtcgccgccgtcggcgcgttcaccgccctgatggtgacgccggatgccaacgccgccgcc
ggcaccctgggtgccgccgccgcccagtccggccgctatttcggcaccgcgatcgccgcg
ggccggctcggcgatgccacctacaccacgatcgccgggcgtgagttcaccatggtcacg
ccggagaacgagatgaagccggacgccaccgaaccgcagcgcggccagttcactttcagc
tccggggaccagatctacaactgggccacccagcgcggcatgaaggtccgcggtcacacg
ctggcctggcattcgcagcagccgggctggatgcagagcctcaacggcagcggcctgcgc
caggccatgatcgaccacatcaacggcgtgatggcccactacaagggcaaactcgcctac
tgggacgtggtcaacgaggcgtacaacgaggatggcagccgtcggcagtcgaatctgcag
ggcaccggcaacgactggatcgaggtggcgttccgcacggcgcgggccgccgacccgtcg
gtcaagctctgctacaacgattacaacatcgagaattggtcgtacgcgaagacccagggc
gtctacaacatgatccgggacttcaagtcgcgcggcgtcccgatcgactgcgtcggcctg
cagacccacttcaccgggggcagctcgctgccgggcaacttcccgaccacgctgtcgagc
ttcgcggcgctgggtgtcgacgtcgcgctgaccgaggtcgacgtcaccaacgcatccacc
tcgcagtacgccgggctcactcaggcctgcgtcaacgtgccccgctgtgtcggcatcacg
gtgtggggcgtgcgggacagcgattcgtggcggtccagcgagagccccctgctgttcgac
ggtggcggcaccaagaaggcggcgtacacctcggtgctcaacgccctgaacgcggccggt
ccggtcacctcgtcgccgaccccgggcggcggctccggttcgccgtcatcgtcgccgtcc
accccgccggccggcaccgggcggatcgtcggcgcccagtccggccggtgcatcgacgtg
ccgaacgcgtcgcagaacaacggcacccgggtgcagctctacgactgcaacggccagacc
aaccaggcgtggacgctcacctccggcaagcagctgaccgtgtacggcaaccgctgcctg
gacgccgcggggtcgggcaacggcgcggccgtgcagatctacagctgcaacgggcaggcc
aaccagcagtggaacgtcaacgccaacgggaccatcaccggcgtgcagtcggggcgctgc
ctcgacgtctggggcaccggtaacggccagcaggtgcagatctacgactgcagtgggcag
gccaaccagcggttcaccctgagctga

DBGET integrated database retrieval system