KEGG   Actinoplanes sp. SE50/110: ACPL_3021Help
Entry
ACPL_3021         CDS       T02044                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00260  Glycine, serine and threonine metabolism
ase00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ase01100  Metabolic pathways
ase01110  Biosynthesis of secondary metabolites
ase01130  Biosynthesis of antibiotics
ase01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACPL_3021 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ACPL_3021 (trpB)
Enzymes [BR:ase01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ACPL_3021 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEV83916
UniProt: G8SA13
Position
3282522..3283736
Genome map
AA seq 404 aa AA seqDB search
MSAPTQMLETAHIETARPHPAAAMEAPTATGRFGEFGGRYVPESLVPACAALAAAFREAW
ADPSFHERLARLRSEYAGRPTALTPAANLSAELGVTLLLKREDLAHTGSHKINNVLGQAV
LAQRMGKTRLIAETGAGQHGVATATAAALFGMRATVYMGERDIDRQRLNVFRMELLGAEV
IPVTSGSRTLKDATNEAMRAWVAAVDEAHFCLGSVAGPHPYPWLVRELQRVIGEEARAQT
PVVPDVVVACVGGGSNAAGTFAGFVDTPARLVGVEAAGGAAMTNGTPGVVHGYRSLILQD
PAGQVLEAESIAAGLDYPGVGPEHAHLGTTGRAEYRTVTDDEVLAAVRRLARSEGIICAL
ESAHAVAWVLRAAGTPDLPAGSTVLLTLSGRGDKDMATLAGEVR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgccgacgcagatgctggagacagcacacatcgagacagcaaggcctcacccg
gccgcggcgatggaggcaccgacggccaccggccgcttcggcgagttcggcgggcgttat
gtgcccgagtcactggtcccggcctgcgccgcgctggcagcggcgtttcgcgaggcctgg
gccgacccgtcattccacgagcggctcgcccggctccgctcggaatatgcggggcgcccc
acagccctcacccccgccgccaacctctccgccgagctcggcgtgaccctgctgctcaag
cgggaggacctggctcacaccggctcccacaaaatcaacaacgtgctcggccaggcagtg
ctggcgcagcggatgggcaagacccggctgatcgccgagaccggcgccggccagcacggc
gtcgccacggccaccgccgccgccctgttcggcatgcgcgccaccgtctacatgggtgag
cgtgacatcgaccgtcagcggctcaacgtcttccggatggagctgctcggcgccgaggtg
atcccggtgaccagcggcagccgcacgctgaaggacgcgacgaacgaggcgatgcgcgcc
tgggtcgccgcagtcgacgaggcacatttctgcctcggatcggtggccggcccgcatccc
tatccgtggctggtccgcgagctgcagcgggtgatcggcgaggaggcccgggcgcagacc
cccgtcgttcccgacgtggtcgtggcctgcgtgggcggcgggtccaacgcggccggcacc
ttcgccgggttcgtggacactccggcgcggctggtcggggtggaggcggccggtggcgcc
gcgatgaccaacgggacacccggcgtggtgcacggctaccgctccttgatcctgcaggat
ccggccggccaggtgctcgaggcggaatcgatcgcggccgggctggactatcccggtgtc
ggaccggagcacgcgcatctggggacgaccggccgggcggaataccgcacggtcaccgac
gacgaggtgctcgccgcggtccggcggctggcccgcagcgaggggatcatctgcgcgctg
gagtcggcgcatgccgtggcctgggtgctgcgcgcggccggcacgcccgatctgcctgcc
gggtcgacggtgctgctcaccctctccggccggggagacaaggacatggcgacgctggcc
ggtgaggtccgatga

DBGET integrated database retrieval system