KEGG   Actinoplanes sp. SE50/110: ACPL_3021Help
Entry
ACPL_3021         CDS       T02044                                 

Gene name
trpB
Definition
tryptophan synthase beta chain (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ase01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ase00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ase00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3282522..3283736
Genome map
AA seq 404 aa AA seqDB search
MSAPTQMLETAHIETARPHPAAAMEAPTATGRFGEFGGRYVPESLVPACAALAAAFREAW
ADPSFHERLARLRSEYAGRPTALTPAANLSAELGVTLLLKREDLAHTGSHKINNVLGQAV
LAQRMGKTRLIAETGAGQHGVATATAAALFGMRATVYMGERDIDRQRLNVFRMELLGAEV
IPVTSGSRTLKDATNEAMRAWVAAVDEAHFCLGSVAGPHPYPWLVRELQRVIGEEARAQT
PVVPDVVVACVGGGSNAAGTFAGFVDTPARLVGVEAAGGAAMTNGTPGVVHGYRSLILQD
PAGQVLEAESIAAGLDYPGVGPEHAHLGTTGRAEYRTVTDDEVLAAVRRLARSEGIICAL
ESAHAVAWVLRAAGTPDLPAGSTVLLTLSGRGDKDMATLAGEVR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgccgacgcagatgctggagacagcacacatcgagacagcaaggcctcacccg
gccgcggcgatggaggcaccgacggccaccggccgcttcggcgagttcggcgggcgttat
gtgcccgagtcactggtcccggcctgcgccgcgctggcagcggcgtttcgcgaggcctgg
gccgacccgtcattccacgagcggctcgcccggctccgctcggaatatgcggggcgcccc
acagccctcacccccgccgccaacctctccgccgagctcggcgtgaccctgctgctcaag
cgggaggacctggctcacaccggctcccacaaaatcaacaacgtgctcggccaggcagtg
ctggcgcagcggatgggcaagacccggctgatcgccgagaccggcgccggccagcacggc
gtcgccacggccaccgccgccgccctgttcggcatgcgcgccaccgtctacatgggtgag
cgtgacatcgaccgtcagcggctcaacgtcttccggatggagctgctcggcgccgaggtg
atcccggtgaccagcggcagccgcacgctgaaggacgcgacgaacgaggcgatgcgcgcc
tgggtcgccgcagtcgacgaggcacatttctgcctcggatcggtggccggcccgcatccc
tatccgtggctggtccgcgagctgcagcgggtgatcggcgaggaggcccgggcgcagacc
cccgtcgttcccgacgtggtcgtggcctgcgtgggcggcgggtccaacgcggccggcacc
ttcgccgggttcgtggacactccggcgcggctggtcggggtggaggcggccggtggcgcc
gcgatgaccaacgggacacccggcgtggtgcacggctaccgctccttgatcctgcaggat
ccggccggccaggtgctcgaggcggaatcgatcgcggccgggctggactatcccggtgtc
ggaccggagcacgcgcatctggggacgaccggccgggcggaataccgcacggtcaccgac
gacgaggtgctcgccgcggtccggcggctggcccgcagcgaggggatcatctgcgcgctg
gagtcggcgcatgccgtggcctgggtgctgcgcgcggccggcacgcccgatctgcctgcc
gggtcgacggtgctgctcaccctctccggccggggagacaaggacatggcgacgctggcc
ggtgaggtccgatga

DBGET integrated database retrieval system