KEGG   Actinoplanes sp. SE50/110: ACPL_3022Help
Entry
ACPL_3022         CDS       T02044                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00260  Glycine, serine and threonine metabolism
ase00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ase01100  Metabolic pathways
ase01110  Biosynthesis of secondary metabolites
ase01130  Biosynthesis of antibiotics
ase01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACPL_3022 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ACPL_3022 (trpA)
Enzymes [BR:ase01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ACPL_3022 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PEP-utilisers_N
Motif
Other DBs
NCBI-ProteinID: AEV83917
UniProt: G8SA14
Position
3283733..3284713
Genome map
AA seq 326 aa AA seqDB search
MKRLNPYLTGGITPDWIDYLLAFQDAGADAVEIGLPFSDPMVDGATIQRASDQALRRGAT
AASILSDLTAARHRIRIPLIAMTYANLVFRGDPQAGEPTRQAGEPTREGGKDTSRANQPV
RGSQATARCGEPTDSGAGATIRGDGPLSGGGDTGGPEAFCRRLAEAGFSGLIVPDVPVDE
ADRLERAAAAAGIDLVLLAAPVTPEDRLTEIGRRSRGFVYAVSVMNTTGERDTLAATAAP
LAARLKAVTDLPVLIGFGISTPAQAATAARAGDGVVIGAALMRRVLDGASPDDLRAEVAA
YRAALDQVDQEMPVARAHAEISGDRR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggctgaatccttacctgaccggtggcatcaccccggactggatcgattacctg
ctggccttccaggacgccggcgccgacgcggtcgagatcggactgccgttctccgacccg
atggtcgacggcgccaccatccaacgagcttccgaccaggcgttgcgccggggagcaacg
gctgcgtcgatcctgtccgacctgaccgcggcgcgtcaccgcatccgcatcccactgatc
gcgatgacatacgccaacctcgtctttcgcggcgacccccaggcaggtgaacccacccgc
caggcaggtgaacccacccgcgaaggtggaaaagacaccagcagagcgaaccagcccgta
cgcggcagccaggcgaccgcccggtgcggcgagcccacagattcgggcgcgggagccacc
atccgaggcgatgggccgttgagcggcggcggggatacgggtgggccggaggcgttctgc
cggcggctggcggaggccgggttctccgggctgatcgtgcccgatgtgccggtggatgag
gccgaccggctggagagggccgcggcggcggccgggatcgacctggtgctgctggccgcg
ccggtcacaccggaggatcggctcaccgagatcggccggcgcagccgagggttcgtctat
gcggtgagcgtcatgaacaccaccggcgagcgtgacacgctggccgcgaccgcggcacca
ctggccgcccggctcaaggcggtgaccgacctgcccgtgctgatcggtttcggcatctcc
acgccggcgcaggcggccacggcggcacgtgccggggacggggtggtgatcggcgccgct
ctgatgcgtagggttctggacggtgcctcacccgacgacctgcgagccgaggtcgccgcc
taccgcgccgccctcgaccaggtcgaccaggagatgcccgttgcccgcgcgcacgccgaa
atatcaggtgatcgccgatga

DBGET integrated database retrieval system