KEGG   Actinoplanes sp. SE50/110: ACPL_3129Help
Entry
ACPL_3129         CDS       T02044                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ACPL_3129
Enzymes [BR:ase01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     ACPL_3129
Peptidases [BR:ase01002]
 Cysteine Peptidases
  Family C44
   ACPL_3129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3419646..3421487
Genome map
AA seq 613 aa AA seqDB search
MSVFAEAAALFAGPMWTIGWPHDGKSSVRSFLAVSGALAPVAPAPVLACLSGDPVVTRTS
TGWVATGGADHGDRIDQDSGAFTVRLGKAARTRTGDVSTEALGVLLRDGVKADGPLLAAL
VPPFAAAHSEGAAAPVIAATDWLGFRQLFWWQGRGVAAVSTSALALRALAEADLDRPALA
VQSLVGWQVGLRTVFAGVHKVPAGCLAVLHDGRILIHRYVEESLAVDGPSPSLEEAAVEQ
AAIMTAFHQAYLRDHPRSVLQLTGGQDTRVLLAAIPAGLRAGLPALTLDVHGGTDSRFAG
RLAAMTGMKLHVHWMDEGPAVTPAEAFALAVRAARELDCMASPLALAPLLRAETQLEQGH
RLSGLGGETCRGFYYFGQPGGATTGPRLIEKLATWRLYANEAVQSEALAPDFAASARADA
LELITASFDGYPTDWLAATDHFYLYQRMQRWSGAHGSVAAANRHFVNPMFDRRFIQLAHA
VRPEEKRHGLLTGRLISLLDPALAAVPLDSGLIPNRLGRPGLAARTAAYRVTAQKAARKI
RQKVRGQGRPQLGAGEMAALVVEHWRSEPDSVAPLRDTGLVRDAWLGEVLAGRATPAPAT
VAFLVNLLAIGEK
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttttcgccgaggcagcggcgcttttcgcagggccgatgtggacgatagggtgg
ccgcatgacgggaaatcttcggtgagatcgttcctcgcggtttccggtgcgctcgcgccg
gtcgccccggccccggtcctggcctgcctcagcggtgacccggtggtcacccgcacgtcc
accggctgggtcgccaccggcggcgccgaccacggtgaccgcatcgaccaggacagcggg
gcgttcaccgtccgcctcggcaaggccgcccgcacccgcaccggcgacgtctccaccgag
gccctcggcgtgctgctgcgcgacggtgtcaaggccgacggcccgctgctggccgcgctg
gtcccgccgttcgccgcggcgcacagcgagggcgccgccgcgccggtgatcgcggccacc
gactggctcggcttccgccagctgttctggtggcagggccggggcgtcgcggccgtctcc
accagtgctctcgcgctgcgcgcgctcgccgaggccgatctcgaccggccggcgctcgcc
gtgcagagcctggtcggctggcaggtcggcctgcgcacggtcttcgccggcgtgcacaag
gtcccggccggctgcctcgcggtcctgcacgacggtcggatcctgattcaccggtacgtc
gaggagtccctcgccgtggacggcccgtccccctcgctcgaggaggcggccgtcgaacag
gcggccatcatgaccgcattccaccaggcgtatctgcgcgaccacccgcgttcggtgctg
cagctgaccgggggacaggacacccgggtgctgctcgccgcgatcccggccgggctgcgc
gccgggctgcccgcgctcaccctggacgtgcacggcggcaccgactcccggttcgccggc
cggctcgccgcgatgaccggcatgaaactgcacgtgcactggatggacgagggcccggcg
gtcaccccggccgaggcgttcgccctggccgtgcgcgccgcccgggaactggactgcatg
gccagcccgctcgccctggccccgctgctgcgcgccgagacccagctggagcagggccac
cggctgtccgggctgggcggcgagacgtgccgcggcttctactacttcgggcagcccggc
ggggcgacgaccgggccgcggctgatcgagaaactggccacctggcggctgtacgccaac
gaggcggtgcagtccgaggccctggcgcccgacttcgcggcgtccgcccgggccgacgcc
ctcgagctgatcaccgcgtcgttcgacgggtaccccaccgactggctggccgcgaccgac
cacttctacctgtatcagcggatgcagcgctggtcgggcgcgcacgggtcggtggccgcc
gccaaccggcacttcgtcaacccgatgttcgaccgacggttcatccagctggcgcacgcg
gtcaggcccgaggagaaacgccacgggctgctcaccggccggctgatcagcctgctcgac
ccggcgctggccgcggtgcccctcgactccgggctgatcccgaaccggctcggcagaccg
ggactggcggcgcgcaccgcggcctaccgggtgaccgcgcagaaggcggcccgcaagatc
cggcagaaggtgcgtggccaggggcgcccgcagctgggtgccggcgagatggccgccctg
gtggtcgagcactggcgatccgaaccggacagtgttgcgccgctgcgcgacaccgggctg
gtccgcgacgcctggctcggcgaggtgctcgccggtcgggccaccccggcgccggccacc
gtcgccttcctggtcaacctgctggcgatcggggagaaatag

DBGET integrated database retrieval system