KEGG   Actinoplanes sp. SE50/110: ACPL_3251Help
Entry
ACPL_3251         CDS       T02044                                 

Definition
putative secreted endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACPL_3251
Enzymes [BR:ase01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     ACPL_3251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3556562..3557467)
Genome map
AA seq 301 aa AA seqDB search
MLRENSALAQQHFYVDPHGRAATQAAQWQADGHSQQAALLRKIADRPVADWVTDGPIPVA
ERVGALVGRAEAAGQLPVLVAYNIPDRDCGGHSSGGAASAARYGEWIRGFARGIGNRPAV
VILEPDAIAHSLQGCAESGERLAVLHDAVTVLKGNSSTSVYLDAGNPGWITDTRQLALAL
RRAGIAEADGFALNVANFYTTSDNITFGNGLSDALGGHIHFVVDTSRNGDGPAPSDDTSR
WCNPPGRALGAAPTTETGQPLVDAFLWVKRPGESDGSCRSGEPPAGQWWPEYALGLAARA
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgggagaacagtgcgctggcacagcagcatttctatgtggatccgcacgggcgc
gcagcgactcaagccgcccagtggcaggccgacggacactcgcagcaggccgccctgcta
cgcaagatcgcggatcggccggtagcagactgggttaccgacggaccgatacccgtggcc
gaacgggtgggcgcactcgtgggtcgggccgaggccgccgggcagctgcccgtgctggtg
gcctacaacatccccgaccgtgactgcggcggtcacagctccggcggcgccgcctccgcc
gcccgttacggcgagtggattcgcggattcgcccggggcatcggcaaccgacccgcggtg
gtgatcctcgagccggacgcgatcgcgcactcgctgcagggttgcgccgaatccggcgag
cgactcgccgtgctgcacgacgcggtcaccgtcctcaagggcaacagctccaccagcgtc
tacctcgacgccggcaacccgggctggatcaccgacacgcgtcagctggcactggcgctg
cggcgggcgggaatcgccgaggcggacggtttcgcgctcaacgtggcgaacttctacacc
acctccgacaacatcaccttcggcaacggcctgtccgacgcgctgggcggccacatccac
ttcgtcgtcgacaccagccgcaacggagacgggccggcgccgagcgacgatacctcccgc
tggtgcaacccgccgggccgcgcgctgggtgcggcaccgaccacagagaccggtcaaccc
ctggtcgacgcctttctgtgggtcaaacgtcccggtgaatccgacggctcctgccgttcc
ggcgagccgcctgccgggcagtggtggccggagtacgccctcggcctcgcggctcgcgct
tcctga

DBGET integrated database retrieval system