KEGG   Actinoplanes sp. SE50/110: ACPL_3674Help
Entry
ACPL_3674         CDS       T02044                                 

Gene name
acbQ
Definition
acarbose 4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ase00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4070134..4072230
Genome map
AA seq 698 aa AA seqDB search
MTTTTDAALIELAGRYGVSVDWTTDRGEPRTVPADTIQRILAVLGVDASSGPAIAAALRA
ADDDARHRLLPSCVVVRQGEPARGVHPVAGAAYVVATEDGGRHETADPRNDLGRLPIGYH
TLRVRVGDRSAAAPVIVAPAVLGTPDRRHWGMLAQIYSVLSERSWGMGDLGDLADLTRWS
ARLGASFVLVNPMHAYVPDRLADPTPYRPGSRRFADPMYLRLADVAEYATAEPAVRAELD
RAARQGHELTAEVLHRNALIDRARVWPVKRNALERLYRAPRTAGRSAALAAFTAREGRGL
EDYATWCALAEVYGTRWRSWPAALQSPHGPAVAAARRELVDRIDFHRWLAWLVDEQMAAA
QAAAVGSGMAIGVIHDLAVGVDPEGADAWAVQDHLAGGVTVGCPADDFNPLGQDWGLPPW
RPDTLAEAGYRPFADVIRGTLRHSGALRLDHILGLFRLWWIPAGSGARDGAYVRYDHEAM
LGVLAVEAFRAGAMIIGEDLGTVHPAVRAELADRGILGTSVLRFEYQGGSENRSGPLPAD
QWRAGCLATLTTHDLPSTAAWLSGEHVDLQDRLGLLNRPRAEVAADAAAERDGWLAELRR
TGLLEHETAVPGMSAESLALHRFLARTPARLVGVWLPDLVGDRRPQNLPGTSTEFPNWQL
PVADADGRPVAMDDLASSAGAQAVAGLYAASAEPATTP
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacgacggatgccgcgctgatcgagctggccggacggtacggggtgtcggtc
gactggaccaccgaccgcggcgagccgcggacggtgccggccgacacgatccagcggatc
ctggctgtgctcggtgtggacgcgagctccggccccgcgatcgccgccgcgctgcgtgcc
gcggacgacgacgcccggcaccggctgctgccgtcctgcgtggtggtgcggcagggggaa
ccggccaggggagtccacccggtggccggggccgcctatgtggtggcgaccgaggacggt
ggccggcacgagacggccgacccgcgcaacgacctcggccgccttccgatcggataccac
acgctgcgcgtacgggtgggcgaccggtccgccgccgcgccggtgatcgtggctccggcc
gtcctcggcaccccggaccggcggcactgggggatgctggcgcagatctactccgtactg
tccgaacggtcctgggggatgggcgacctcggcgacctggccgacctgacccgctggtcg
gcccggctcggggcgtcgttcgtgctggtcaatccgatgcacgcctacgtgccggaccgc
ctggccgaccccacgccctaccggccgggcagccggcggttcgccgacccgatgtatctg
cggctggccgacgtcgccgagtacgcgaccgcggaaccggcggtgcgggccgaactcgac
cgggccgcccgtcagggacacgaactgaccgccgaggtgctgcaccggaacgcgctgatc
gaccgggctcgggtgtggccggtcaagcggaacgccctggagcggctctaccgggcaccc
cgcacggccgggcggtccgcggctctggccgccttcaccgcccgcgagggccggggtctc
gaggactacgccacctggtgtgcgctggccgaggtgtacggcacccgctggcgttcctgg
ccggccgctctgcaatccccgcacggcccggcggtcgccgccgcccgccgcgagctggtc
gaccggatcgatttccaccgctggctggcctggctcgtcgacgagcagatggccgcggcc
caggcggccgccgtcgggtccggcatggcgatcggcgtgatccacgacttggccgtcggc
gtcgacccggagggtgccgacgcgtgggcggtgcaggatcatctggccggcggtgtcacg
gtgggctgcccggccgacgacttcaacccgctcgggcaggactgggggttgccgccgtgg
cgcccggacaccctggccgaagccggttaccggccgttcgccgacgtgatccgcggcacc
ctgcggcacagcggggcgctgcggctggaccacattctcggcctgttccggctctggtgg
atcccggccgggagcggcgcccgcgacggtgcctacgtccgctacgaccacgaggccatg
ctcggggtgctggccgtcgaggcgttccgggccggggcgatgatcatcggcgaggatctg
ggcaccgtccatccggcggtccgtgccgaactcgccgaccggggcatcctcggcacgtcc
gtgctgcgcttcgagtaccagggcggatcggagaaccgcagcgggccgctgccggccgac
cagtggcgtgccggctgcctggccaccctcaccacccacgacctgccgagtacggccgcc
tggctcagcggtgagcacgtggacctgcaggaccggctgggcctgctgaaccggccccga
gccgaggtggccgccgacgcggcggccgaacgtgacggctggctggccgagttgcggcgc
accggtctgctggagcacgagaccgccgtaccggggatgagcgccgagtcgctggccctg
caccggttcctggcccggaccccggcccgcctggtcggagtgtggctgcccgacctggtc
ggcgaccggaggccgcagaacctgccgggcaccagcaccgagttcccgaactggcagctg
ccggtcgccgacgccgacggccggccggtggcgatggacgacctggcgtcctcggccggc
gcccaagcggtcgccggcctgtacgccgcatcggccgagccggccaccacaccctga

DBGET integrated database retrieval system