KEGG   Actinoplanes sp. SE50/110: ACPL_3844Help
Entry
ACPL_3844         CDS       T02044                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ase00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ACPL_3844
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACPL_3844
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ACPL_3844
Enzymes [BR:ase01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ACPL_3844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4257763..4258191)
Genome map
AA seq 142 aa AA seqDB search
MSAVLSPFPAQVGAGADDGLPRLLVGQPERWATIADTVNGVDRAGRGERVPTVAEGAAIA
SPVRLPEAVEALRRCGGAAVAVAEEQIHGAVRALATRGLYAEPTSAVAAAALDHFIADGT
ITPDQTTVVVLTGSGLKSADKR
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgtgctgtcccccttcccggcccaggttggtgccggagcagacgacgggctg
ccccggctgctcgtcgggcagcccgagcgctgggccaccatcgccgacaccgtcaacggc
gtcgaccgggccggacgcggtgagcgggtgccgaccgtcgctgaaggggcggccatcgcc
agccccgtacggctgccggaggccgtcgaggccctgcgtcgctgtggcggcgcggcagtc
gccgttgccgaggaacagattcacggtgcggtccgcgccttggctacccgcggcctgtac
gccgaaccgaccagtgccgtcgcggcggccgcactcgaccacttcatcgctgacggcacc
atcactcctgatcagacgactgtggtcgtgctcaccggctcggggctgaagtcggccgac
aagaggtaa

DBGET integrated database retrieval system